Histoire de la Chimie

Discussion dans 'Bibliothèque Wladbladi' créé par titegazelle, 24 Janvier 2013.

  1. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113




    L'histoire de la chimie est intrinsèquement liée à la volonté de l'Homme de comprendre la nature et les propriétés de la matière, plus particulièrement la façon dont celle-ci existe ou se transforme.

    L'histoire de la chimie débute avec la découverte du feu qui est la première source d'énergie utilisée par l'homme pour améliorer son quotidien ; éclairage, chauffage, cuisson des aliments etc. La maitrise du feu a permis de réaliser les premières transformations contrôlées de la matière, notamment la fabrication du verre et de la céramique mais également d'alliages métalliques. L'histoire de la chimie est également marquée par les nombreuses tentatives pour développer une théorie cohérente de la matière parmi lesquels on peut citer les théories atomique de Démocrite et des éléments d'Aristote pendant la période antique ou le développement de l'alchimie au Moyen Âge.

    La chimie ne se distinguera de cette dernière que vers leXVII[SUP]e[/SUP] siècle, notamment par les travaux de Robert Boyle qui applique la méthode scientifique à ses expériences. La publication de son célèbre Sceptical Chymist en 1661 est d'ailleurs parfois considérée dans le monde anglo-saxon comme le point de départ de la chimie moderne. Plus tard, les travaux de Lavoisier sur les lois de la conservation de la masse contribueront à placer définitivement la chimie au rang de science. Actuellement l'interdisciplinarité dans le monde scientifique fait qu'il est parfois difficile de différencier l'histoire de la chimie de celle de la physique ou des sciences de la vie telle que la biochimie.


    Préhistoire


    Les fondements de la chimie doivent être mis en rapport avec la découverte par l'homme du feu à l'époque paléolithique, 400 000 ans avant notre ère, et qui s'achève à la fin de la dernière période glaciaire, 8 000 ans avant notre ère. Outre le fait qu'il permit à l'homme de se chauffer et de cuire ses aliments, le feu peut aussi être considéré comme la première source d'énergie utilisée par l'homme. Cette énergie lui permit tout d'abord de transformer ses aliments (cuisson des aliments) mais également de réaliser de nouveaux matériaux comme des poteries par cuisson de l'argile. Le charbon de bois est également utilisé comme pigment dans les peintures préhistoriques dans les grottes ou les abris sous roche. Il sera par la suite également utilisé comme combustible.

    Peu à peu, l'attention des hommes semble avoir été attirée par certaines roches ou pierres colorées : l'ocre rouge (oxyde de fer extrait des argiles à hématite), l'ocre jaune (oxyde de fer extrait des argiles à goethite et limonite), pierres bleues ou vertes (carbonates de cuivre, azurite ou malachite), pierres violettes à base d'oxyde de manganèse (manganite, pyrolusite).

    Il y a 10 000 ans, le bitume naturel est exploité par les peuples du Moyen-Orient pour ses nombreuses propriétés. Il est utilisé en tant que matière première pour la conception de bâtiments.

    Antiquité


    L'Antiquité voit les débuts de la métallurgie (paléométallurgie), c'est-à-dire l'extraction par l'homme des métaux à partir des minerais présents dans la nature, généralement sous forme de sels. Ces métaux seront ensuite retravaillés et utilisés soit sous forme pure soit en tant qu'alliage.

    • Or : utilisé à l'état natif depuis les débuts de l'Antiquité. Métal inaltérable et de très faible réactivité chimique il n'a, durant cette période, fait l'objet d'aucune transformation chimique. Considéré alors comme un métal parfait, il revêt une valeur monétaire et artistique importante
    • L'argent : présent à l'état natif sous forme d'alliage avec l'or (électrum). Il peut également être extrait de la galène
    • Le cuivre : il a pu être trouvé à l'état natif mais également sous forme impure dans la malachite. Son commerce pendant l'Antiquité sera une importante source de richesse
    • Le bronze : premier alliage fabriqué par l'homme. C'est l'airain (aes) des anciens. Les premiers alliages de cuivre découverts proviennent de Turquie (Catal Huyuk). Ce sont des alliages cuivre-arsenic. Le bronze apparait aux alentours de l'an -6000 (Âge du bronze) et sera rapidement utilisé dans la fabrication d'armes. L'étain qui va se substituer à l'arsenic entre pour 10 % environ dans la composition des bronzes Romains.
    • Le fer : Il est possible qu'il ait été découvert il y a environ 3 800 ans en Anatolie par les Hittites, mais il pourrait également être originaire d'Inde où des objets de fer très anciens ont également été trouvés. Ses premières utilisations, également pour des applications militaires, datent de 2500 avant J-C. Son usage est plus tardif car sa fabrication requiert des fours permettant d'obtenir des températures plus élevées. Le fer n'existe pas à l'état natif (mis à part le fer provenant de météorites qui est d'ailleurs allié au nickel). Pour l'obtenir il est nécessaire de réduire les oxydes de fer à l'aide de charbon de bois. L'homme s'aperçut alors que l'ajout d'une certaine quantité de carbone rendait le fer plus tranchant et plus résistant. Ce fut l'apparition du premier acier.
      [*]Le laiton : alliage constitué de cuivre et de zinc apparait vers 1000 av. J.-C. ; on en a trouve notamment dans des pièces romaines.
      [*]Le bitume et l'asphalte naturels servaient de mastic pour étanchéité (imperméabilité) pour la confection de coupes et de statuettes et pour cimenter les briques.

    Égypte
    Les Égyptiens auraient inventé le verre il y a environ 3 800 ans à partir du sable du désert et du natron chauffés au four jusqu'à fusion auxquels on ajoute souvent de la chaux. À partir de -1800 environ, ils savent aussi extraire le fer de ses minerais. Les Égyptiens connaissent la fermentation qui leur permet de produire de la bière. Ils fabriquent des colorants (indigo, cinabre), utilisés notamment pour les fards (malachite). Les Papyrus d'Ebers (1600 avant J.-C.) et de Brugsch (fin duXIV[SUP]e[/SUP] siècle av. J.-C.) nous montrent de plus les connaissances en médecine et en pharmacie des Egyptiens.

    Chine (article très long, sera traité à part)

    Inde

    Les Indiens sont parmi les premiers peuples à avoir fabriqué du fer. Ils ont développé un art très poussé de cette métallurgie au fil des siècles. Au Moyen Âge, le métal des lames des meilleures épées étaient appelé damasquiné en occident, car on l'approvisionnait depuis Damas. Ces lames étaient pourtant faites d'un acier Indien : le wootz. Le pilier de fer de Delhi constitue un autre témoignage de la haute qualité des fabrications Indiennes de fer. Le déclin de la métallurgie Indienne s'amorce vers leXIV[SUP]e[/SUP] siècle.

    Grèce

    • On sait que les Minoens (du XXVII[SUP]e[/SUP] au XII[SUP]e[/SUP] siècles av. J.-C.) grillaient la pyrite (FeS[SUB]2[/SUB]) pour l'utiliser comme minerai de fer.
    • Certains historiens des sciences considèrent Thalès de Milet comme le fondateur de la chimie, car il fait de l'eau le principe explicatif de l'univers. Pour son disciple, Anaximène de Milet, l'élément primordial est l'air qui devient feu par dilatation, puis vent. Un peu plus tard, Xénophane de Colophon propose la terre comme racine de toute chose. Pour Héraclite, le feu est à l'origine des choses.
    • Pour Empédocle (V[SUP]e[/SUP] siècle av. J.-C.), il existe quatre éléments de base : l'eau, l'air, le feu et la terre qui s'attirent ou se repoussent. Platon reprend plus tard cette théorie en associant ces quatre éléments à des formes géométriques reliées à des nombres de triangles. Ainsi le feu est associé au tétraèdre (4 triangles équilatéraux) qui a les arêtes les plus pointues (d'où le fait qu'il pique), la Terre au cube (24 triangles rectangles isocèles signe de stabilité), l'Air à un octaèdre (8 triangles équilatéraux) et l'Eau à un icosaèdre (20 triangles équilatéraux). Aristote, élève de Platon, reprendra le modèle des quatre éléments en leur associant 4 qualités : l’humide, le sec, le chaud et le froid. Chacun des éléments est alors décrit comme l’association de 2 qualités (par exemple : le feu est une combinaison des qualités sec et chaud). Les écrits d'Aristote seront traduits en arabe et, plus tard, traduits en latin par Thomas d'Aquin et Roger Bacon. Le médecin Galien introduira au II[SUP]e[/SUP] siècle les quatre humeurs (sang, phlegme, bile jaune et bile noire) comme une combinaison des qualités d’Aristote : la médecine de Galien restera une référence pendant l’Antiquité et tout le Moyen Âge.
    • Le philosophe Anaxagore voit le monde en perpétuel changement, sans création ni destruction de matière mais avec des réarrangements des particules élémentaires.
    • Leucippe puis Démocrite pensent que la matière est composée d'entités élémentaires, les atomes. Ceux-ci sont insécables, limités en diversité et forment la matière "comme les lettres forment les mots". Cette théorie atomique, divulguée par Épicure et Lucrèce, servira de base à l'alchimie. Les atomes crochus assurent la cohésion de la matière tandis que les atomes ronds expliquent la fluidité des liquides.
    • Vers 40 après J.-C., un médecin grec, Dioscoride, mentionne le soufre dans ses écrits ainsi qu'une poudre blanche obtenue par calcination de certaines pierres servant à produire l'orichalque.

    Rome

    Vers 30 avant J.-C., Vitruve, dans son ouvrage traitant des matériaux et techniques de construction Architectura, cite plusieurs matériaux dont la chaux, le ciment romain, l'ocre, l'orpiment, la pourpre, la garance, le pastelPline l'Ancien, dans son Histoire naturelle, récapitule les substances chimiques connues à son époque dont le soufre, le naphte, le gypse. D'autres substances, connues bien avant les Romains, sont mentionnées dans des documents comme les papyrus de Leyde et de papyrus de Stockholm, les lapidaires (données sur les pierres précieuses) et des ouvrages de Zosime de Panapolis.
    En plus des substances citées antérieurement, nous trouvons:


    • le cristal de roche ou quartz utilisé par les Romains pour la fabrications de loupes.
    • la pierre de magnésie susceptible d'exercer une action sur le fer.
    • l'alun.
    • le sel de Cappadoce.
    • la fleur de cuivre (chalcanthon) ou vitriol.
    • le vif-argent (mercure) ou argent liquide qui forme facilement des amalgames avec les métaux.
    • le nitre ou salpêtre de couleur blanche, soluble dans l'eau.
    • la litharge ou l'orpiment employé dans les alliages pour remplacer l'or, trop onéreux.
    Parmi les techniques connues, citons le bain-marie et la distillation qui fournit divers esprits (produits légers) et des huiles (produits lourds, moins volatils). L'esprit de naphte et l'huile de naphte étaient, à titre d'exemple, obtenus par distillation du naphte.

    Naissance de l'alchimie


    • L'alchimie naît à Alexandrie vers le IX[SUP]e[/SUP] siècle av. J.-C.. Les alchimistes cherchent à fabriquer à partir de métaux divers le métal parfait qu'est l'or. L'objectif est la fabrication de la pierre philosophale qui transmute les métaux en or et permet la préparation de la panacée ou remède universel. L'alchimie est aussi une recherche spirituelle et demande une initiation à ses secrets. Les corps sont classés en solides, liquides et vapeurs et selon leur couleur. Ils interagissent suivant des notions de sympathie et d'antipathie. Cette philosophie repose sur la théorie des quatre éléments de Platon complétée par l'introduction de la quintessence (la 5[SUP]e[/SUP] Essence ou le cinquième élément).
    • Soufre, mercure et sel: le soufre et le mercure sont issus de l'alchimie arabe et le sel de Paracelse. Au soufre se rattache tout ce qui est chaud, dur et masculin; au mercure tout ce qui est froid, féminin; quant au sel il assure le cohésion du soufre et du mercure lors de leur union.
    Moyen Âge
    - Civilisation arabe

    - Occident
    - Bases de l'alchimie

    • L'alchimie arrive en Europe avec les traductions des textes arabes. De nombreux termes (comme alcali ou alambic, par exemple) seront d'ailleurs repris directement de la langue arabe. Par ailleurs, en raison de la grande peste qui sévit alors, l'alchimie prétend améliorer la santé par des potions ou remèdes à base de substances chimiques connues. En 1317, le pape Jean XXII à Avignon, réagit contre les fraudes dans les monnaies et les faux métaux contenant de l'or.
    Il existait au début du Moyen Âge une relation importante entre l'alchimie et l'astrologie. À cette époque, sept métaux étaient connus (Au, Ag, Cu, Fe, Sn, Pb, Hg) et l'astrologie comptait sept planètes (en incluant le Soleil et la Lune). La liaison s'établissait ainsi :
    - Soleil - l'or (Au)
    - Mercure - le mercure (Hg)
    - Vénus - le cuivre (Cu)
    - La Lune - l'argent (Ag)
    - Mars - le fer (Fe)
    - Jupiter - l'étain (Sn)
    - Saturne - le plomb (Pb)

    Certaines expressions du langage perpétuent cette association. Par exemple, le saturnisme désigne une intoxication au plomb. Il convient également de signaler, au XIX[SUP]e[/SUP] siècle le clin d'œil par des scientifiques lors de la découverte d'éléments radioactifs qui furent nommés uranium, neptunium et plutonium en rapport avec le nom des trois planètes uranus, neptune et pluton alors inconnues au Moyen Âge.

    Robert Grossetête et Roger Bacon, qui prône l'expérimentation comme méthode de travail pour les chimistes, sont représentatifs de cette époque. Albertus Magnus (Albert le Grand), moine dominicain, était un chimiste et alchimiste apprécié. C'est lui qui isola pour la première fois l'arsenic.

    - Les recettes
    Beaucoup d'expériences de transmutation débouchèrent sur des recettes métallurgiques et sur la préparation de nouveaux composés :

    • le vitriol: H[SUB]2[/SUB]SO[SUB]4[/SUB] (acide sulfurique)
    • l'eau forte: HNO[SUB]3[/SUB] (acide nitrique)
    • l'esprit de sel: HCl (acide chlorhydrique)
    • le vitriol de lune: Ag[SUB]2[/SUB]SO[SUB]4[/SUB] (sulfate d'argent)
    • les cristaux de Vénus: Cu(NO[SUB]3[/SUB])[SUB]2[/SUB] (nitrate de cuivre)
    • la poudre noire. (mélange déflagrant de salpêtre (du latin sal petrae signifiant "sel de pierre"), de soufre, de charbon de bois)
    • l'esprit de vin à plusieurs degrés d'alcool. (éthanol)
    • l'eau régale capable de dissoudre l'or. (mélange d'acide nitrique et d'acide chlorhydrique 1:3)
    Aucun progrès théorique dans ces recettes ésotériques qui sont souvent des recopies d'ouvrages antérieurs, mais un développement notable de l'instrumentation et des manipulations.

    Chine et Orient


    • Invention de la poudre à canon par les chinois au X[SUP]e[/SUP] siècle de notre ère. qui sera remplacée à partir de 1847 par la nitroglycérine par Ascanio Sobrero.
    Renaissance etXVI[SUP]e[/SUP] siècle

    La Renaissance est une réaction intellectuelle contre l'état de fait et le pouvoir ecclésiastique (Galilée, la Réforme avec Calvin et Luther, Concile de Trente, guerres de religion…). En effet, jusqu'à cette période, la recherche d'une explication autre que divine aux phénomènes naturels est interdite jusqu'à l'héliocentrisme de Nicolas Copernic (1473 - 1543). Cette période est celle de l'humanisme, mais les anciens auxquels on se réfère, commencent à être tenus une certaine distance. La chimie va se détacher progressivement de l'alchimie, Andreas Libavius, par exemple, est un alchimiste représentatif de cette époque.

    Paracelse
    Paracelse, par sa pratique de la médecine et ses recherches sur les médicaments (iatrochimie), est considéré comme un précurseur de la chimie moderne quoiqu'il se réfère à la théorie des quatre éléments et au vitalisme. Il rappelle les vertus thérapeutiuqes du soufre et du mercure. D'autres métaux comme l'arsenic, l'antimoine et le bismuth seront mentionnés dans les ouvrages de médecine de la Renaissance. Une polémique naîtra sur la toxicité ou non des remèdes contenant de l'antimoine. Avec Vésale, on distinguera la pharmacie chimyque (laboratoire) de la pharmacie ordinaire (herbes médicinales). De nombreux instruments de manipulation: spatules, appareils de distillation, alambics, cornues...ont été inventés dans les laboratoires des alchimistes.

    Les ingénieurs
    Les nouvelles idées sont véhiculées par des traductions d'ouvrages issus du grec ou de l'arabe, l'imprimerie contribuant à la diffusion du savoir. De nombreux minéraux, végétaux et animaux sont ramenés des voyages par les grands navigateurs Vasco de Gama, Christophe Colomb, Magellan, Jacques Cartier, Francis Drake. Cette révolution scientifique en Occident conduit à développer l'esprit d'expérimentation allié aux techniques de calcul (l'algèbre de Raphaël Bombelli paraît en 1572) dans les laboratoires et les premières usines. Les besoins militaires (artillerie, canon, poudre noire…) vont favoriser de façon importante le développement des mines et la production de métaux et d'alliages. C'est donc la quantification par le biais des instruments de mesure qui caractérise le plus la Renaissance: mesures de pression, de température (invention du baromètre par Evangelista Torricelli (1643), thermomètre)… C'est le temps des ingénieurs. Bernard Palissy (1499 - 1589) se spécialise vers 1463 dans la production d'émaux et de faïence. En 1540, Vannoccio Biringuccio, qui publie De la pirotechnia libri, est le précurseur de la pyrotechnie.

    Agricola
    Georg Bauer dit Agricola (1494 - 1555) fonde la chimie métallurgique et définit plus précisément métaux et alliages : il étudie plus particulièrement la galène, la blende et mentionne le zinc et le bismuth. Son principal ouvrage posthume, (De Re Metallica), qui paraît en 1556, est un traité de métallurgie comportant des précisions sur la production de vitriol vert dont l'huile est particulièrement corrosive. Le charbon de bois, employé jusqu'ici pour le chauffage des minerais sera progressivement remplacé par le charbon de terre (houille). En 1546, il publie De natura fossilium, premier traité de minéralogie (le terme minéralogie sera mentionné par Bernardo Cesi en 1636) .

    XVII[SUP]e[/SUP] siècle


    Les métiers de ce siècle (teinturiers, apothicaires, mineurs, métallurgistes, distillateurs, ingénieurs militaires…) sont représentatifs de l'esprit scientifique de l'époque. Il n'y a pas de percée théorique en chimie (contrairement à la physique : Descartes, Newton, Leibniz), malgré le grand nombre d'ouvrages scientifiques (voir par exemple Johannes Hartmann), d'expériences et de découvertes qui se succèdent. L'alchimie en déclin laisse place à la théorie du phlogistique et à la chimie pneumatique.

    Atomisme et phlogistique
    Pierre Gassendi (1592 - 1655) reprend en 1624 les théories atomiques de l'Antiquité et précise la notion d'atome et en 1620, Francis Bacon, qui publie Novum Organum, prend parti pour l'atomisme. Georg Ernst Stahl (1659 - 1734) crée la phlogistique (du grec phlogiston, la terre inflammable). Selon cette théorie, toute matière combustible contient du phlogiston (du feu), qui s'échappe lorsqu'elle brûle. En 1630, Jean Rey (1583 – 1645), médecin, constate avant l'heure, qu'un métal chauffé à l'air forme une chaux (oxyde) plus lourde que le métal, ce qui pose question dans le cadre de la phlogistique. Vers 1680, Johann Joachim Becher (1635 - 1682) écrit que les corps combustibles et les métaux sont composés de terres vitrifiables, inflammables (qui se dégagent par combustion) et mercurielles. Newton, qui est alchimiste en plus d'être physicien, pense qu'il existe des forces entre les particules, comparables aux forces de gravitation. En recherchant la pierre philosophale, Hennig Brandt obtiendra en 1669 le phosphore par distillation de l'urine humaine.

    Les gaz
    Jan Baptist van Helmont (1577 - 1644) différencie les gaz et caractérise le gaz sylvestre (CO[SUB]2[/SUB]). C'est à l'issue d'expériences, et non d'intuitions, qu'il énonce ses résultats. Il obtient, par exemple, le gaz sulfureum par combustion du soufre et constate qu'il forme avec l'eau l'oléum sulphuris. Par ailleurs, on sait à l'époque que le gaz sylvestre peut être obtenu par diverses méthodes: action du vinaigre sur le calcaire, combustion du charbon, fermentation du raisin… En ce qui concerne le vinaigre, Johann Rudolf Glauber découvre que le vinaigre de vin et le vinaigre de bois sont de même nature. Il fonde, en 1650 à Amsterdam, une usine chimique de savon et de verre. Après la mise au point du verre de cristal au plomb en 1676, l'art de la verrerie est étudié par Johannes Kunchel en 1689 et Jean Haudicquer de Blancourt en 1697. En 1662, Robert Boyle (1627 - 1691) établit la loi des gaz à température constante et publie The Sceptical Chymist et Edme Mariotte fait paraître en 1679 son essai sur l'air et complète la loi des gaz de Boyle.

    Un traité de chimie
    En 1675, Nicolas Lémery publie le premier grand traité de chimie. La nature est divisée en minéraux, végétaux et animaux. La théorie des sept métaux et l'absence de symboles fait apparaître la chymie plus comme un art que comme une science. Il introduit la notion de mixte (mélange) et de corps dont les éléments ne peuvent être chimiquement séparés. Il définit les acides (huile de vitriol, eau régale, eau forte), les vitriols, les alcalis (bases) et les sels.

    XVIII[SUP]e[/SUP] siècle


    Ce siècle connaîtra la multiplication des laboratoires et des publications scientifiques. Les manufactures et usines vont prendre leur essor et une multitude de nouvelles substances vont apparaître. De nouveaux thèmes d'études, comme la combustion, la calcination (transformation du calcaire en chaux) et la réduction des minerais (cassitérite en étain, galène en plomb), la respiration des végétaux... seront approfondis. la chimie va devenir une science comme en témoignent les ouvrages de Pierre Joseph Macquer éléments de chymie théorique (1749), Dictionnaire de Chymie (1766) et d'Antoine Baumé, Maître apothicaire de Paris, Chymie expérimentale et raisonnée 3 tomes (1773), avant d'attendre Lavoisier et son Traité élémentaire de chimie (1789) et la loi de conservation de la masse. L'alchimie est toujours aussi populaire et revêt même un caractère spectaculaire et mercantile (Giacomo Casanova).

    Retour sur le phlogistique
    Georg Ernst Stahl, qui effectue un certain nombre de travaux sur la combustion, publie Zymotechnia fundamentalis en 1697, suivi de Fundamenta Chymiae dogmatica et experimentalis en 1723. Il constate que, lorsqu'on chauffe un métal, celui-ci donne de la chaux, qui elle-même chauffée en présence de charbon, redonne le métal initial. Il en déduit que le principe combustible présent dans le métal s'échappe de celui-ci lors de sa calcination et est libéré avec la flamme. De même, le charbon de bois réduit le minerai car il contient, lui aussi, le même principe combustible, le phlogiston ou phlogistique qui doit être considéré comme un élément parmi les autres. La cendre de bois, par exemple, est du bois déphlogistiqué par combustion. Cette théorie est officiellement diffusée par Rouelle en 1742

    La chimie pneumatique ou chimie des gaz
    À la suite de diverses expériences sur les animaux, on se pose la question de savoir si la digestion est une opération mécanique de broyage ou une transformation chimique comme le pensent les chimistes. Stephen Hales montre en 1727 que l'air est nécessaire à la croissance des plantes par l'intermédiaire des feuilles. Il invente, pour son expérience, la cuve à eau qui sera à la base de bien des expérimentations. C'est avec ce procédé que Joseph Black observe la calcination de la chaux. En 1757, il mettra en évidence l'air fixe (c'est le gaz sylvestre de Van Helmont ou anhydride carbonique) en montrant que l'action d'un acide sur le calcaire donne un gaz qui trouble l'eau de chaux. (Un chimiste, Joseph Jacquin, remarquera que le poids de chaux obtenu après calcination est inférieur au poids de calcaire avant chauffage…). Black note aussi que le calcaire, attaqué par un autre acide, donne lieu à un dégagement de « gaz des métaux ».

    Une des limites de l’utilisation de la cuve à eau était la difficulté de mettre en évidence certains gaz plus ou moins solubles dans l’eau. Priestley, en 1792, utilise le mercure à la place de l’eau dans ses expériences sur l’air. Il obtient, en 1774, par calcination à l'aide d'une lentille du rouge de mercure (HgO), un gaz, qu’il nomme air déphlogistiqué, qui sera appelé plus tard oxygène, qui permet la respiration et entretient la combustion.


    Découverte d’autres gaz
    En 1765, Henry Cavendish isole l'air inflammable (hydrogène). Trois sortes d’air sont connus à l’époque de Cavendish : l’air normal ou atmosphérique, l’air des métaux (ou air inflammable car il entretient la combustion) et l’air fixe (qui, au contraire, arrête la combustion). En mesurant la densité de ces trois gaz vers 1765, Cavendish établit que l’air fixe est plus lourd que l’air atmosphérique et l’air inflammable, que Cavendish assimile au phlogistique beaucoup plus léger. Pour réaliser cette expérience, il se sert d’un eudiomètre.

    Daniel Rutherford découvre, en 1772, un autre gaz qu’il nomme air phlogistiqué ou air nuisible (azote). En résumé, le phlogistique est reconnu comme l’air inflammable, l’air déphlogistiqué trouble l’eau de chaux alors que l’air phlogistiqué ne la trouble pas. En 1772, Joseph Priestley isole l'air nitreux (oxyde azotique), l'air d'acide marin (gaz chlorhydrique) et l'air nitrique peroxyde d'azote et l'air vitriolique (anhydride sulfurique).

    Tout ceci va rester confus et la théorie du phlogistique va subsister jusqu’à Lavoisier. Scheele découvre en 1773 l'acide marin déphlogistiqué (ou esprit de sel) en faisant agir l'acide muriatique sur la pyrolusite (dioxyde de manganèse). Ce produit, étudié par Berthollet sera ultérieurement utilisé en 1785 pour le blanchiment du linge et la production d'eau de Javel. En faisant agir de nouveau l'acide muriatique sur un mélange intime de soufre et de limaille de fer qu'il enflamme, Scheele obtient un gaz encore inconnu caractérisé par une forte odeur d'œufs pourris qu'il nomme air de soufre. En 1777, Pierre Bayen (1725 - 1798) contestera, avant Lavoisier, la théorie du phlogistique.

    Les acides et les bases
    Le concept d’acide prend progressivement forme au cours duXVIII[SUP]e[/SUP] siècle. On distingue les acides en provenance du non vivant. Ce sont : l’acide acétique ou vinaigre, l’acide sulfurique ou huile de vitriol, l’eau-forte (ou acide nitrique) obtenu à partir de salpêtre, l’acide muriatique ou esprit de sel (acide chlorhydrique) et les acides phosphorique et benzoïque (à partir du benjoin).

    Certains acides commencent à être extraits du vivant ; ils sont, pour la plupart, issus des travaux de Scheele à partir de 1760. Citons, dans l’ordre chronologique, l’acide tartrique à partir du tartre (1769), l’acide urique à partir des calculs urinaires (1776), l’acide lactique à partir du lait (1780), l’acide citrique à partir du citron (1784), l’acide malique à partir des pommes (1785), l’acide gallique à partir des noix de galle (1786), l'acide oxalique à partir du sucre et de l’eau forte (1784). Il en est de même de l’acide fluorhydrique à partir d’huile de vitriol et de fluorine et de l’acide prussique obtenu par l’action de l’acide sulfurique sur un colorant, le bleu de Prusse.

    En ce qui concerne les bases, nous savons que Lavoisier utilisait la potasse (ou alcali végétal) et la soude (alcali marin) qui avaient déjà été distingués par Duhamel du Monceau. Ce dernier, avec son collaborateur Jean Grosse, obtiennent la « liqueur de Frobenius » par action de l’huile de vitriol (acide sulfurique) sur l’esprit de vin (alcool éthylique). Jean Grosse met au point la technique de distillation de l’alcool en milieu sulfurique et précise les conditions d’obtention d’un produit pratiquement pur[SUP]1[/SUP]. L'ammoniac (alcali volatil) et le natron étaient également connus.

    Métallurgie et chimie industrielle
    De nouveaux métaux sont découverts : le cobalt par George Brandt en 1735. En 1751, Alex Frederik Cronsted découvre le nickel. Le manganèse est extrait de la pyrolusite en 1780 (Johann G. Gahn) et le molybdène est découvert en 1782. (Jacques Hjelm). La découverte du tungstène surviendra l’année suivante. En 1791,William Gregor découvre le titane et Johan Gadolin l’yttrium. En 1797, Nicolas Vauquelin caractérise le chrome et le tellure est découvert en 1798 par Martin H.Klaproth.


    Dans le domaine de la métallurgie, le charbon de bois est remplacé progressivement par le coke que l’on chauffe pour obtenir de l’acier à partir de la fonte. C’est à cette époque que Benjamin Hunstmann invente l’acier au creuset. En 1743, une fonderie de zinc est créée à Bristol. Les travaux de Lavoisier permettront une meilleure connaissance des métaux et des minerais qui se présentent sous la forme d’oxydes (cassitérite, hématite…) que l’on chauffe en présence de charbon comme dans les hauts-fourneaux. Le charbon joue à la fois le rôle de source de chaleur et de réducteur. Pour les sulfures, comme la blende, on effectue un grillage dans un courant d’air, de telle sorte que l’oxygène oxyde le métal alors que l’anhydride sulfureux se dégage.
    Le début de la chimie industrielle est caractérisé par le procédé de fabrication d’acide sulfurique (huile de vitriol) des chambres de plomb mis au point par John Roebuck.


    Antoine Lavoisier
    C’est en 1765, que Antoine Lavoisier publie ses travaux sur le gypse. Ses études sur la combustion le mènent à la conclusion que l’air déphlogistiqué est de l’oxygène. Lors de la combustion, un combustible nécessite de l’oxygène alors que le résultat de la calcination est une chaux (oxyde) moins de l’oxygène. Cette nouvelle théorie du phlogistique est publiée en 1776 et approfondie en 1785. Lors de la combustion du phosphore dans l’air, Lavoisier constate la formation d’un gaz résiduel (l'azote) qu’il nomme mofette atmosphérique et qui correspond à l’air phlogistiqué caractérisé par Rutherford en 1772. Il établit que l’air atmosphérique est composé de 20 % d’oxygène et de 80 % de mofette.

    Il précise également, dans son expérience sur la décomposition de l’eau (dont la synthèse eudiométrique sera effectuée par Cavendish), que celle-ci est un corps simple composé d’air inflammable (hydrogène) et d’oxygène. Au vu de ces résultats, il sera définitivement admis, en 1785, que ni l’air ni l’eau ne sont des éléments chimiques.

    Avec Guyton-Morveau, il définit de manière visionnaire une notion d'élément chimique, qui ne diffère essentiellement de la nôtre qu'en ce qu'elle inclut la lumière et le calorique. L'ancienne Chymie disparaît.
    Lavoisier est également le premier à insister de manière aussi nette sur la conservation de la masse lors d'une réaction chimique.


    Affinités et nomenclature
    Au début du siècle, on tente de comprendre comment les corps ou éléments chimiques peuvent s’attirer les uns vers les autres. Un premier début d’explication est tenté, en 1718, par Geoffroy. Les éléments connus à l’époque sont classés dans une table des différents rapports ou affinités dont l’idée sera reprise en 1761 par Christlieb Gellert, puis, la même année, par Jean-Philippe de Limbourg dans une nouvelle table des affinités chymiques. Karl Scheele effectuera également le même type de classement.

    En 1787, Guyton de Morveau, Lavoisier, Berthollet et Antoine de Fourcroy publieront une méthode de nomenclature chimique, ouvrage considéré comme essentiel pour la clarification et la mise en forme des connaissances en chimie. Un tableau, résumant les 55 substances connues en six catégories, mentionnées et commentées, complète cet ouvrage divisé en deux parties : d’une part les oxydes, acides, bases, sels…et d’autre part les substances tirées des végétaux et animaux. Un dictionnaire accompagne l’ouvrage et traite des synonymes. Il faut mentionner toutefois l’absence de symboles chimiques malgré une tentative de Hassenfratz et Adet. C'est Berzelius qui introduira un peu plus tard ces symboles permettant de représenter les composés chimiques.

    Deux ans plus tard, Lavoisier publiera Le Traité élémentaire de chimie, un ouvrage capital où apparaîtront nommément l’hydrogène, l’oxygène et le carbone. En 1792, Richter publie l'Art de la mesure des éléments chimiques et remarque que les rapports pondéraux d'éléments sont constants dans certaines familles chimiques et en 1794, Joseph Louis Proust établit la Loi des proportions définies.


    XIX[SUP]e[/SUP] siècle


    C'est au cours de ce siècle que la chimie prend véritablement son essor : théorie atomique de Dalton, lois sur les gaz, hypothèse d'Avogadro, calcul des poids atomiques, naissance de la chimie organique, théorie de la valence, chimie structurale et classement des éléments par Mendeleïev et classification périodique des éléments. À la fin du siècle, physique et chimie contribueront à la découverte de la radioactivité.

    L’électrolyse et la découverte de nouveaux éléments
    C’est en 1800 qu’Alessandro Volta invente la pile électrique. Le cérium est découvert par Wilhelm Hisinger en 1803. En 1804, l’iridium et l’osmium sont découverts par Smithson Tennant et la même année, William Wollaston isole le palladium et le rhodium. Les lois de l’électrolyse, approfondies par William Nicholson et Anthony Carlisle, vont mettre en évidence la dissociation d’une solution aqueuse acide ou basique sous l’action de l’électricité. On obtient deux gaz : deux volumes d’hydrogène et un volume d’oxygène. Ces résultats donnent l’idée à Humphrey Davy de soumettre à l’électrolyse, non plus des solutions, mais des corps fondus comme la potasse. Il constate la formation d’un métal : potassium ou sodium autour d’un des fils. Avec la même méthode il isolera, en 1808, les métaux terreux : le magnésium, le calcium, le strontium et le baryum. En 1810, il montre que l’acide marin déphlogistiqué, ou oxyde muriatique, est un corps simple : le chlore. L’acide muriatique est l’acide chlorhydrique. En 1834, Michael Faraday énonce les lois quantitatives de l’électrolyse. Svante August Arrhenius propose, en 1883, une théorie de l’électrolyse pour interpréter la loi de Faraday, basée sur l’existence de charges atomiques élémentaires ions.

    Les débuts de la chimie organique
    Berzelius la définit en 1808, comme la chimie des êtres vivants, définition imprégnée de vitalisme. Au départ, c’est la chimie des dérivés du carbone connus et des substances contenues dans le gaz d'éclairage. William Murdoch avait mis au point l’éclairage au gaz de houille en 1792 et 1799. L’éclairage au gaz de bois (thermolampe) avait été breveté par Philippe Lebon. Le développement urbain de ces nouvelles techniques avait conduit à la conception d’usines à gaz, de moyens de stockage et de tuyaux d’acheminement pour la distribution. Le goudron est un sous produit du gaz d'éclairage qui empêche la putréfaction du bois et qui est utilisé pour le calfatage des coques de bateau en bois. Il se présente sous forme d’un liquide visqueux, noir à forte odeur caractéristique. À l’époque, il existe d’autres substances organiques : teinture, savon, tannage… En 1802, Fourcroy et Vauquelin établissent que l’acide formique est un mélange d’acide malique et d’acide acétique (dont Berzelius établira la formule en 1814). En 1805, Friedrich Sertürmer isole la morphine, puis en 1817 Joseph Pelletier l’émétique. Ces découvertes de produits alcaloïdes seront suivies l’année suivante par la brucine, le strychnine, la colchinine, substances découvertes par Joseph Caventou et Pelletier qui isoleront, en 1820, la quinine et la caféine. En 1823, Jean Antoine Chaptal fera paraître son ouvrage Chimie appliquée à l’agriculture. Faraday découvre le carbureted hydrogen (C[SUB]6[/SUB]H[SUB]6[/SUB]) dans le gaz d'éclairage en 1825. En 1826, Otto Undervorben isole la crystallin de l’indigo par distillation et Gay-Lussac extrait l’acide racémique du tartre.

    L’année 1828 est importante : Pelletier et Cavendou isolent la nicotine et Friedrich Wohler réalise la synthèse de l’urée. Il démontre la possibilité d’obtenir des substances organiques (urée) à partir des substances minérales (cyanate d’argent et chlorure d’ammonium). La saliciline est extraite de l’écorce de saule par Pierre-Joseph Leroux en 1829 (le lancement commercial de l’aspirine par Bayer aura lieu en 1899). En 1833, Jean-Baptiste Dumas établit la formule du camphre.

    Chevreul et les corps gras
    Chevreul s’intéresse vers 1810 aux matières grasses utilisées dans l’industrie : savonneries, alimentation, éclairage, textile (ensimage). En 1813, il montre que l’action d’un alcali sur la graisse de porc forme un savon et libère de la glycérine. Il montre, la même année, en faisant agir de l’acide sulfurique dilué sur le savon, que celui-ci est formé de deux acides : l’un solide (margarine), l’autre liquide (graisse fluide). La graisse de porc est donc constituée de glycérine, margarine et graisse fluide. En 1814, il extrait du beurre l’acide butyrique et des calculs biliaires, la choléstérine. Les acides stéarique et oléique sont des sels qui sont dissociés par les alcalis en glycérine et acide et qui se recombinent au métal de l’alcali. Les sels d’acides gras sont obtenus à partir de la potasse et donnent des savons mous, alors que ceux obtenus à partir de la soude donnent des savons durs. En 1817, Chevreul étudie l’acide delphique. Les acides caprique et caproïques seront caractérisés l’année suivante. En faisant bouillir des os d’animaux, Braconnot obtient en 1820, par l’action de l’acide sulfurique dilué sur le gélatine un ‘sucre de gélatine’. Dans son ouvrage paru en 1823, Recherches chimiques sur les corps gras d’origine animale, Michel Chevreul effectue un classement des corps gras rencontrés dans ses travaux. Les glycérides comme la stéarine (glycérine et acide stéarique) résulteront des combinaisons de glycérine et d’acides gras. La rupture du lien entre glycérine et acides gras par l’action de la soude (hydroxyde de sodium) sera appelée saponification. Tous les corps gras ne sont pas saponifiables. À la suite de tous ces travaux, dès 1825, les bougies en stéarine remplaceront les chandelles en suif d’animal.

    Chimie quantitative
    Peser des quantités de produits implique l’utilisation de la balance. Les travaux de Richter sur la stœchiométrie en 1792 et la loi des proportions définies (1802) reposent sur des pesées entachées d’incertitudes de précision : dans un corps composé, la teneur en divers éléments est constante. John Dalton, en 1804, effectue l’analyse quantitative du gaz des marais et du gaz oléfiant qui sont tous deux des composés binaires à base d’hydrogène et de carbone. Il énonce la loi des proportions multiples : lorsque des composés différents sont formés des mêmes éléments, les proportions de ceux-ci sont dans un rapport simple. Cette loi sera complétée en 1805 par la loi de Gay-Lussac sur les gaz.

    La théorie atomique, exposée par Dalton en 1803 dans A new system of chemical philosophy, suppose que les atomes possèdent une masse bien déterminée appelée masse atomique que Dalton calcule pour certains composés. Elle explique particulièrement bien les lois ci-dessus et la loi de conservation de la masse. Elle aura ses partisans et ses adversaires (Berthollet). Un système de symboles viendra compléter cet exposé : le symbole représente un atome, un élément doté d’une masse. La molécule est représentée par l’association des symboles d’atomes consécutifs. Le poids atomique sera différent d’un chimiste à l’autre (7,8,10 par exemple pour l’oxygène). C’est en 1811 qu’Amedeo Avogadro publie sa théorie du Nombre d'Avogadro : un litre de gaz soit 1/22,4 mole contient toujours le même nombre N de particules (atomes pour un corps simple, molécules pour un corps composé). C’est Joseph Loschmidt qui, en 1865, tentera le premier une évaluation de N proche de 4.10[SUP]23[/SUP]. En 1873, Johannes Van der Waals trouvera N = 6,2.10[SUP]23[/SUP]. En 1814, Berzelius utilisera les symboles de Dalton et établira des équivalences entre atomes. Il utilisera des lettres comme symboles : P (phosphore), S (sulphur)… et mettra le nombre d’équivalents d’une molécule en notation exposant. Les formules étaient écrites de la façon suivante : CaCO[SUB]3[/SUB] : CaO, CO[SUB]2[/SUB] / CuSO[SUB]4[/SUB] : CuO, SO[SUB]3[/SUB]. Dans ce système dualiste, la première partie est basique : CaO, CuO sont des oxydes de métaux, le seconde partie est acide : CO[SUB]2[/SUB], SO[SUB]3[/SUB] sont des oxydes de non métaux. Lors du premier congrès international de la chimie qui se déroulera à Karlsruhe en 1860, Cannizzaro exposera les concepts d’atomes et molécules admis par la plupart des chimistes. Marcellin Berthelot, cependant, s’opposera au réalisme atomique.

    Vers la synthèse en chimie organique
    Scheele établit la formule de l’acide tartrique (C[SUB]4[/SUB]H[SUB]6[/SUB]O[SUB]6[/SUB]) en 1830. Celle de l’acide racémique découverte par Gay-Lussac est la même. Ces deux acides, que l’on trouve dans le tartre, ont des points de fusion différents. Berzelius nomme ces corps des isomères.

    En 1832, Justus von Liebig établit que l’acide lactique a la même formule chimique C[SUB]3[/SUB]H[SUB]6[/SUB]O[SUB]3[/SUB], qu'il provienne du lait ou de la viande.

    En 1833, Jean-Baptiste Dumas précise la formule du camphre (C[SUB]10[/SUB]H[SUB]16[/SUB]O) et Christopher Zeise celle du mercaptan C[SUB]2[/SUB]H[SUB]6[/SUB]S.
    La même année, Eilhard Mitscherlich obtient le benzène en chauffant l’acide benzoïque qui peut être obtenu à partir de la houille.

    En 1834, Jean-Baptiste Dumas, en faisant agir l’acide acétique sur le chlore, met en évidence la substitution partielle de l’hydrogène par le chlore en acide chloracétique. Il établit la formule du chloroforme, obtenu par Liebig et Carl Runge.

    En 1835, Justus von Liebig et Dumas caractérisent les groupes éthyle et méthyle.

    En 1836, Berzelius définit la catalyse.
    L’aniline, obtenue en 1841 par Carl Fritzsche par distillation de l’indigo, permet l'élaboration de la mauvéine en 1856.

    En 1842, John Leigh produit le nitrobenzène qui redonne l’aniline par l'action du sulfure d’ammonium.

    En 1843, Charles Frédéric Gerhardt obtient le bornéol à partir du camphre. Les séries homologues, les groupes fonctionnels seront définies entre 1842 et 1850 par Auguste Laurent, la chiralité en 1848 (Louis Pasteur).

    En 1855, Charles Adolphe Wurtz mettra au point sa célèbre synthèse (réaction de Wurtz) pour la préparation des hydrocarbures.
    La synthèse de l’acide formique sera réalisée par Marcellin Berthelot en 1856, celle de l’acide salicylique par Hermann Kolbe en 1859 (à partir du phénate de sodium obtenu par l’action du phénol sur la soude).

    En 1864, la synthèse de Rudolf Fittig et Tollens aboutit au toluène.
    En 1894, Henri Moissan obtient de l’acétylène à partir du carbure de calcium.
    En 1884, le comte Hilaire de Chardonnet invente la soie artificielle et construisit en 1891 une usine affectée à la production de Viscose.


    Structure des composés organiques
    La notion de chaîne carbonée est introduite par Kékulé en 1857 pour définir les enchaînements d’atomes de carbone dans une molécule.
    La représentation de lien interatomique par un tiret est due à Archibald Couper. Cette représentation, contrairement à la formule brute, conduit aux formules développées et permet de préciser la disposition des atomes dans les molécules et la compréhension des mécanismes réactionnels.

    En 1860, Kékulé différencie les corps gras aliphatiques et les composés aromatiques tels les acides salicylique et benzoïques.
    La notion de liaison multiple, due à Joseph Loschmidt (1863), permet d’expliquer l’hydrogénation. L’hydrogénation catalytique sera développée en 1897 par Paul Sabatier et Senderens.
    En 1864, August Wilhelm von Hofmann suggère une nomenclature pour alcanes et alcènes.

    C’est en 1865, que Kékulé propose la formule cyclique du benzène. La tétravalence du carbone est un des principes fondamentaux de la chimie organique. Cette formule sera revue en 1872 par l’introduction de liaisons transitoires dans le cycle benzénique.
    L’isomérie géométrique, définie en 1863, est étudiée par Joseph Achille Le Bel au cours de travaux sur l’acide lactique. Il propose une représentation spatiale des formules des formes lévogyre et dextrogyre. Jacobus Henricus van 't Hoff complètera ces travaux par la notion de carbone tétraédrique.

    En 1888, Adolf von Baeyer explique l’isomérie des acides malique et fumarique (qui possèdent des points de fusion différents), par l’isomérie cis-trans.
    La stéréochimie, terme de (Victor Meyer), constitue la façon de représenter ces différents isomères.


    Découverte de nouveaux éléments
    La chimie minérale progresse très rapidement après que la notion d'élément chimique a été mieux comprise.

    Une nouvelle technique, l'analyse spectrale, verra le jour en 1859. Mise au point par Robert Bunsen et Gustav Kirchhoff elle leur permet de caractériser le césium et le rubidium en 1860. Le thallium sera identifié par William Hookes en 1861, en utilisant la même méthode.

    Les tentatives de classement des éléments chimiques en fonction de leurs propriétés ont été assez nombreuses. On citera par exemple celle de Johann Wolfgang Döbereiner effectuée en 1829. Mais c’est en 1869 que le chimiste Russe Dmitriï Mendeleïev propose sa classification des 62 éléments connus. Pour Mendéléiev, la classification périodique correspond à une véritable loi naturelle, et il n'hésite pas à modifier les valeurs de certains poids atomiques pour en justifier l'évidence. Sa conviction est telle qu'il prédit la découverte d'éléments manquants qu'il qualifie d'eka-éléments. La découverte de ces éléments au fil de la seconde moitié du siècle assoit peu à peu la confiance que mettent les chimistes dans cette classification qui sera d'ailleurs revue, notamment suite à l'émergence de la notion de numéro atomique et à la mise en évidence des nombres quantiques s, p, d caractéristiques des orbitales atomiques.

    La découverte d’éléments continue au fil du siècle:


    Colorants synthétiques et caoutchouc
    La synthèse chimique va surtout se développer dans les domaines des médicaments et des colorants. En 1807, Jean-Antoine Chaptal publie l’Art de la teinture du coton rouge. En 1838, Alexandre Wosrerenski obtient la quinone à partir de la quinine. Dès 1842, l’acide picrique est utilisé dans l’industrie comme colorant synthétique. En 1849, l’essence de térébenthine est à la base du ‘nettoyage à sec. La pyridine est obtenue par distillation du goudron de houille par (Thomas Anderson). William Henry Perkin réussit à obtenir du pourpre d’aniline ou mauvéine en traitant l’aniline par le bichromate de potassium. Le rouge d’aniline ou fuschine sera fabriqué un peu plus tard. La société Bayer sera créée en Allemagne en 1863, puis la BASF en 1865. En 1867, la formule du naphtalène extrait du goudron de houille est établie. La synthèse de l’alizarine (1868) sera industrialisée par BASF en 1870 par Carl Graebe est réussie en 1875 par Friedrich Tiemann. La théorie des colorants avec les groupements chromophores et auxochromes sera l’œuvre, en 1876, de Otto Nikolaus Witt. En 1875, Ramsay réalise la synthèse de la pyridine. Enfin, Adolf von Baeyer met au point la synthèse de l’indigo en 1879 que BASF commercialise en 1897.
    En ce qui concerne le caoutchouc, l’invention du pneumatique en 1888 (Dunlop) débouchera vers une fabrication industrielle par Michelin en 1889 puis Goodyear.

    Métallurgie
    Un nouveau métal, l’aluminium est découvert par Wöhler en 1827. Les mécanismes et réactions survenant dans un haut-fourneau pour produire de l’acier sont de mieux en mieux comprises : carburation, affinage. En 1826, Henry Bessemer invente un nouveau convertisseur qui sera complété en 1878 par un nouveau procédé de production (acier Thomas). C’est à cette époque que les aciers spéciaux au manganèse sont mis au point par Robert Hadfield. En 1863, l’étude de la trempe conduit à la métallographie et à la caractérisation de cémentite et de ferrite. La structure de la martensite des aciers trempés par Floris Osmond sera étudiée en 1890.
    En 1860, l’invention du pyromètre à thermocouple par Henri Le Chatelier permettra la mesure de températures élevées. Il faudra attendre 1886 pour que Paul Héroult produise l’aluminium par électrolyse.


    Rayons cathodiques, rayons X et radioactivité
    La nature des rayonnements cathodiques dans un tube de Hittorf est approfondie par William Crookes en 1886. Ce sont des rayons de nature corpusculaire appelés électrons, dès 1891, par George Stoney et reconnus expérimentalement comme tels par Jean Perrin en 1895. Ces rayons cathodiques sont constitués de particules négatives électrisées pouvant se mouvoir dans le vide et subissant l’action des champs électriques et magnétiques. Joseph John Thomson parvient, par des mesures de déviations de trajectoire, à déterminer le rapport entre la charge électrique e de l’électron (1,602.10[SUP]-19[/SUP] C). et sa masse m (9,109.10[SUP]-31[/SUP] kg) qui représente environ 1/2000[SUP]e[/SUP] de celle de l’atome d’hydrogène. Ces découvertes et mesures, plutôt du domaine de la physique, conduiront au modèle d’atome de Thomson et effaceront les doutes sur l’existence des atomes formulés au premier Congrès des chimistes de 1860.

    Vers les années 1890, on remarque que des rayons cathodiques frappant le verre d’une ampoule provoquent une fluorescence du verre. Wilhelm Röntgen constate, en 1895, en plus de la fluorescence observée, la présence d’un nouveau rayonnement invisible, énergétique et pénétrant, capable d’impressionner une plaque photographique entourée de papier noir. Ces mystérieux rayons X seront utilisés en radiographie car ils traversent la sulfate double d’uranium et de potassium émettent un rayonnement semblable aux rayons X : les atomes d’uranium, quel que soit le composé dans lequel il se trouvent, émettent des ‘rayons uraniques’, phénomène différent de la fluorescence provoquée par les rayons X.

    Cette activité particulière des atomes d’uranium, émission continue d’énergie, est appelée ‘radioactivité’ par Pierre Curie et Marie Curie en 1898, après mesure de l’ionisation produite par les rayons uraniques au moyen d’un électroscope. C’est à l’aide de cet instrument qu’ils découvriront qu’un échantillon de pechblende possède une radioactivité élevée due, non pas à l’uranium seul, mais au polonium et au radium, deux éléments nouveaux contenus dans le minerai. En 1899, Ernest Rutherford montrera que les ‘rayons uraniques’ se composent de deux rayonnements distincts : rayons alpha et rayons bêta. Il découvre aussi la radioactivité du thorium. La même année, André Debierne, trouve l’actinium, un nouvel élément radioactif. En 1923, l’émanation du radium, elle-même radioactive, sera appelée radon. Un rayonnement, plus pénétrant que les rayons X, est émis par le radium et observé par Paul Villard en 1900 qui le nomme ‘rayon gamma’. LeXIX[SUP]e[/SUP] siècle s’achève donc sur le début de la chimie des rayonnements : alpha, bêta, gamma, X et sur la découvertes de nouveaux éléments radioactifs qui feront l’objet de recherches approfondies.

    En 1824, le ciment Portland complètera le ciment hydraulique de John Smeaton mis au point en 1715 à base de chaux.

    XX[SUP]e[/SUP] siècle


    Sources

    Bibliographie




    ______________________________
    Les textes sont disponibles sous
    licence Creative Commons paternité partage à l’identique
    Nom de la page : Histoire de la chimie
    Contenu soumis à la licence CC-BY-SA 3.0.
    Source : Article Histoire de la chimie de Wikipédia en français (auteurs)
    ______________________________


    \A SUIVRE/

    LA CHIMIE

     
  2. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113


    Chimie


    La chimie est une science de la nature. Elle est divisée en plusieurs spécialités expérimentales et théoriques à l'instar de la physique et de la biologie avec lesquelles elle partage parfois des espaces d'investigations communs ou proches.
    Selon l'American Chemical Society (ACS), une grande association de chimistes au monde, la chimie étudie :

    1. les éléments chimiques à l'état libre, atomes ou ions atomiques, et les innombrables et diverses associations par liaisons chimiques qui engendrent notamment des composés moléculaires stables ou des intermédiaires plus ou moins instables. Ces entités de matière peuvent être caractérisées par une identité reliée à des caractéristiques quantiques et des propriétés précises ;
    2. les processus qui changent ou modifient l'identité de ces particules ou molécules de matière, dénommés réaction, transformation, interaction... ;
    3. les mécanismes intervenant dans les processus chimiques ou les équilibres physiques entre deux formes. Leurs définitions précises permettent de comprendre ou d'interpréter avec des hypothèses l'évolution matérielle avec en vue une exploitation des résultats de façon directe ou induite ;
    4. les phénomènes fondamentaux observables en rapport avec les forces de la nature qui jouent un rôle chimique, favorisant les réactions ou synthèse, addition, combinaison ou décomposition, séparation de phases ou extraction. L'analyse permet de découvrir les compositions, le marquage sélectif ouvre la voie à un schéma réactionnel cohérent dans des mélanges complexes.
    La taille des entités chimiques varie des simples atomes ou molécules nanométriques aux édifices moléculaires de plusieurs dizaines de milliers d'atomes dans les macromolécules, l'ADN ou protéines de la matière vivante (infra) micrométrique, jusqu'à des dimensions parfois macroscopiques des cristaux. En incluant l'électron libre composant des réactions radicalaires, les dimensions des principaux domaines d'application se situent globalement entre le femtomètre (le fermi ou 10-15 m) et le micromètre (l'impropre et trivial micron ou 10-6 m).

    L'étude du monde à l'échelle moléculaire soumise paradoxalement à des lois singulières, comme le prouvent les récents développements nanotechnologiques, permet de mieux comprendre les détails de notre monde macroscopique. La chimie est qualifiée de «science centrale» en raison des puissants liens qu'elle possède avec la biologie et la physique, ainsi qu'avec la médecine, la pharmacie, l'informatique et la science des matériaux, sans oublier des domaines appliqués tels que le génie des procédés.
    La physique et surtout son instrumentation sont devenus hégémoniques après 1950 dans le champ de la science de la matière. Les avancées en physique ont surtout refondé en partie la chimie physique et la chimie inorganique. La chimie organique par l'intermédiaire de la biochimie a partagé des recherches valorisant la biologie. Mais la chimie n'en garde pas moins une place incontournable et légitime dans le champ des sciences exactes : elle fournit des produits, découvre ou invente des structures moléculaires qui bénéficient de façon extraordinaire à la recherche physique ou biologique. Enfin, il ne faut pas déconsidérer l'héritage cohérent que les chimistes défenseurs marginaux des structures atomiques ont légué aux acteurs de la révolution des conceptions physiciennes au tout début du XXe siècle.

    Étymologie et Histoire
    Étymologie
    Trois étymologies sont fréquemment citées, mais ces hypothèses peuvent être reliées :

    • l'une égyptienne, kemi viendrait de l'ancien égyptien Khemet, la terre. Il se retrouve aussi dans le copte chame « noire » puisque dans la vallée du Nil, la terre est noire. L'art de la kemi, par exemple les poisons minéraux, a pu influencer la magie noire. La terre d'Égypte elle-même aurait été fort anciennement une terre conquise par des peuples noirs ;
    • la racine grecque se lie à χυμεία, khumeia, «mélange de liquides» (χυμός, khumos, «suc, jus»);
    • enfin, certains étymologistes assurent que «chimie» proviendrait de l'arabe al kemi,الكيمياء (littéralement la kemia, la «chimie»), venant du grec χεμεία, khemeia, qui signifie «magie noire», mot lui-même venant de l'égyptien ancien kem qui désigne la couleur noire.
    Note

    • Al kem signifie aujourd'hui en arabe la quantité, attestant que la chimie passe par une précoce approche quantitative de la matière, couvrant indistinctement le champ des premiers procédés chimiques comme celui du dosage en pharmacopée.
    • Khem(et) désigne la terre pour les anciens égyptiens. La chimie est l'art de la terre et le savoir sur la terre.
    • En persan, "Kimiya", "kimyaw" ou "Kamyâb" pour les iraniens d'aujourd'hui, signifie rare. Rhazès (Razi), l'alchimiste perse du IX[SUP]e[/SUP] siècle, cherchait à obtenir un élément rare capable de transformer les métaux en or.
    Origines
    L'art d'employer ou de trier, préparer, purifier, de transformer les substances séchées mises sous forme de poudres, qu'elles proviennent du désert ou de vallées sèches a donné naissance à des codifications savantes. Elles sont d'abord essentiellement minérales. Mais les plantes éphémères et les arbres pérennes du désert, et leurs extraits gommeux ou liquides nécessaires aux onguents, ont été très vite assimilés à celles-ci, par reconnaissance de l'influence des terres et des roches.

    Outre la connaissance du cycle de l'eau et les transports sédimentaires, la maîtrise progressive des métaux et des terres, les Anciens Egyptiens connaissent le plâtre, le verre, la potasse, les vernis, le papier (papyrus durci à l'amidon), l'encens, une vaste gamme de couleurs minérales ou pigments, de remèdes et de produits cosmétiques... Plus encore que les huiles à onction ou les bains d'eaux ou de boues relaxant ou guérisseurs, la chimie est un savoir sacré qui permet la survie, par exemple par l'art sophistiqué d'embaumer ou par le placement des corps des plus humbles dans un endroit sec.
    L'art de la terre égyptien a été enseigné en préservant une conception unitaire. Les temples et les administrations religieuses ont préservé et parfois figé le meilleur des savoirs. Le pouvoir politique souverain s'est appuyé sur les mesures physiques, arpentage et hauteur hydraulique des crues, peut-être sur la densité du limon en suspension, pour déterminer l'impôt et sur les matériaux permettant les déplacements ou la mobilité des armées. Le vitalisme ou les cultes agraires et animaux, domaines appliqués de la kemia, ont été préservés dans des temples, à l'instar d'Ammon, conservatoire des fumures azotées et de la chimie ammoniacale antique.

    Évolution avant l'apparition d'une science mécaniste

    Au cours des siècles ce savoir empirique oscille entre art sacré et pratique profane. Il s'est préservé comme l'atteste le vocable chimia des scolastiques en 1356, mais savoir et art de faire sont souvent segmentés à l'extrême, parfois amélioré dans le monde paysan, artisan ou minier avant de devenir une science expérimentale, la chimie, au cours des troisième et quatrième décennies du XVII[SUP]e[/SUP] siècle. Au même titre que la physique, le prodigieux essor de la pensée et de la modélisation mécanistes, fait naître la chimie sous forme de science expérimentale et descriptive. Riche de promesses, la chimie reste essentiellement qualitative et bute sur le retour incessant des croyances écartées.

    Les alchimistes ont subsisté jusqu'en 1850. Ils étaient acceptés par les croyances communes, poursuivant la quête de la pierre philosophale et continuant l'alchimie sous une forme ésotérique. La rupture entre la chimie et l'alchimie apparaît pourtant clairement en 1722, quand Étienne Geoffroy l'Aîné, médecin et naturaliste français, affirme l'impossibilité de la transmutation. La chimie expérimentale et l'alchimie diffèrent déjà radicalement ; il est donc nécessaire de pouvoir distinguer ces deux termes restés dans le langage.

    La chimie a connu une avancée énorme avec Antoine Lavoisier qui l'a promue en science exacte. Lavoisier reste dans l'Histoire comme celui qui a découvert la combustion par l'oxygène (1775). Le philosophe Thomas Samuel Kuhn considère qu'il s'agit d'une révolution scientifique majeure, qui a donné naissance à la chimie moderne.
    Les biographies des savants français et étrangers sont répertoriées dans les articles catégorie: chimiste ou dans la liste de chimistes.

    Représentations de l'atome et de la molécule
    L'étude qualitative de la matière a naturellement conduit les premiers chimistes des années 1620-1650 à modéliser sa composition, puisant librement, mais non sans méfiance dans une abondante tradition antique. À la suite de Van Helmont, ces adeptes mécanistes de la contingence maîtrisent déjà la notion de gaz, tiennent compte du facteur de la température et parviennent à expliquer sommairement la pression de vapeur d'un corps et les mélanges miscibles des fluides. John Dalton, persévérant expérimentateur, continuateur de la première lignée mécaniste partiellement abandonnée, a le premier essayé de donner une définition moderne de la notion d'atome. L'atome est une particule fondamentale ou une combinaison de plusieurs d'entre elles. En 1811, Amedeo Avogadro affirme que le volume d'un gaz quelconque à pression et température constante contient le même nombre de particules, qu'il dénomme molécules intégrantes ou constituantes.

    Mais il a encore fallu l'obstination de nombreux chimistes souvent incompris, Jons-Jakob Berzelius en pionnier de l'électrovalence dès 1812, pour réaffirmer la possibilité d'une modélisation à la fois mécaniste et géométrique par le biais d'une architecture atomique. Un Auguste Laurent, proposant pour des séries homologues de molécules organiques un même squelette constitué d'atomes, était atrocement dénigré par les maîtres des laboratoires. Mais malgré la suprématie et l'influence politique des équivalentistes, le revirement s'opère, porté par la reconnaissance des vieux succès de l'électrochimie préparative depuis Humphrey Davy et Michael Faraday et la volonté de corréler quantitativement nombre d'espèces chimiques et masse d'un corps pur.

    Le congrès de Karlsruhe organisé en 1860 par les amis de Friedrich August Kékulé von Stradonitz et de Charles Adolphe Wurtz ouvre la voie à des conventions atomiques. Son influence éveille une intense recherche de classification des éléments qui débouche notamment sur les classifications périodiques de Mendéléiev et de Meyer. Elle entraine un renouveau d'intérêt pour les molécules. Kékulé et Kolbe en chimie organique, Le Bel et Van 't Hoff en chimie générale et plus tard Alfred Werner en chimie minérale établissent les fondements de la représentation en structures moléculaires.

    Ce sont les physiciens attirés par la belle cohérence de la chimie des décennies suivantes qui ont poursuivi à une échelle plus précise les recherches sur la structure de la matière. Les travaux de Joseph John Thomson, découvreur de l'électron en 1897, prouvent que l'atome est constitué de particules électriquement chargées. Ernest Rutherford démontre par sa célèbre expérience en 1909 que l'atome est surtout fait de vide, son noyau, massif, très petit et positif, étant entouré d'un nuage électronique. Niels Bohr, précurseur de la modélisation atomique, affirme en 1913 que les électrons circulent sur des «orbites».

    Lorsque James Chadwick découvre les neutrons, la théorie quantique fondée dès le début de l'entre-deux-guerres sur le modèle rival proposé par Erwin Schrödinger renforcée pas les compléments matriciels de Werner Heisenberg, l'affinement théorique de Wolfgang Pauli a déjà pris son envol malgré les contestations appliquées et systématiques d'Albert Einstein. Des années 1930 à notreXXI[SUP]e[/SUP] siècle, la mécanique quantique explique le comportement de l'atome et des molécules.

    Méthodes physiques d'identification de composés chimiques au XX[SUP]e[/SUP] siècle
    AuXX[SUP]e[/SUP] siècle, l'essor des mesures physiques a facilité aux chimistes la caractérisation des composés avec lesquels ils travaillent. Avant, la réaction chimique et un nombre restreint de techniques physico-chimiques s'imposaient en ultime recours pour détecter ou caractériser une molécule. Maintenant les diverses méthodes de chromatographie, de spectrométrie électromagnétique (infrarouge, lumière visible ou UV), de masse, de résonance magnétique nucléaire, les microscopies électroniques et autres analyses par diffraction de rayons X ou par diffusion de particules et, dans des cas d'observation contrôlée sur surface plane, la microscopie par champ de force ont permis une identification plus aisée, et souvent de remonter à la structure géométrique des molécules et de leurs assemblages, de connaître leur composition isotopique et parfois même de « voir » par le multiplicateur instrumental la molécule, de la (dé)placer ou de suivre des réactions (photo)chimiques en temps réel de plus en plus bref. Ces progrès physico-chimiques ont permis des avancées énormes tout particulièrement en biochimie où les édifices étudiés sont complexes et les réactions variées.

    Disciplines de la chimie


    La recherche et l'enseignement en chimie sont organisés en disciplines qui, souvent en absence de services, de coopération ou d'aides réciproques, s'ignorent et se développent en toute autonomie :

    • la biochimie qui étudie les réactions chimiques dans des milieux biologiques (cellules…) et/ou avec des objets biologiques (protéines…) ;
    • la chimie analytique est l'étude des méthodes d'analyses qualitatives et/ou quantitatives qui permettent de connaître la composition d'un échantillon donné ; ses principaux domaines sont : la chromatographie et la spectroscopie ;
    • la chimie des matériaux est la préparation et l'étude de substances avec une application en tant que matériau. Ce domaine intègre des éléments des autres domaines classiques de la chimie avec un intérêt particulier pour les problèmes fondamentaux concernant les matériaux ;
    • la chimie inorganique ou chimie minérale, concerne la description et l'étude des éléments chimiques et des composés sans squelette carboné ;
    • la chimie organique est la description et l'étude des composés comportant un squelette d'atomes de carbone (composés organiques) ;
    • la chimie physique dont l'objet est l'étude des lois physiques des systèmes et procédés chimiques ; ses principaux domaines d'étude comprennent : la thermochimie, la cinétique chimique, l'électrochimie, la radiochimie, la sonochimie et les spectroscopies ;
    • la chimie théorique est l'étude de la chimie à travers un raisonnement théorique fondamental (habituellement à l'aide des mathématiques et de la physique). En particulier, l'application de la mécanique quantique à la chimie a donné naissance à la chimie quantique. Depuis la fin de la seconde guerre mondiale, le progrès des ordinateurs a permis le développement de la chimie numérique (ou computationnelle).
    Il existe d'autres domaines spécialisés ou d'interface : agrochimie, astrochimie, catalyse homogène, catalyse hétérogène, carbochimie, chimie de l'atmosphère terrestre et de la haute atmosphère, chimie bioinorganique, chimie du carbone, chimie environnementale, chimie industrielle, chimie médicinale, chimie nucléaire, chimie organométallique, chimie des argiles et zéolithes, chimie de la combustion et des milieux plasma, chimie des polymères, chimie des sucres, chimie des surfaces, chimie des solutions, chimie radicalaire, chimie supramoléculaire, chimie verte, électrochimie, génie chimique, géochimie, immunochimie, microchimie, nanotechnologie, pétrochimie, pharmacologie, photochimie, phytochimie, tribologie, sonochimie.

    Ces interfaces mouvantes ne facilitent pas la délimitation de la chimie. Tentons d'esquisser ses frontières.

    • Avec la physique
      Il n'existe pas de frontière clairement définie entre la physique et la chimie, mais, sont considérés généralement comme relevant de la chimie, les phénomènes provoqués par les réactions entre les constituants de la matière et entraînant une modification des liaisons entre les atomes. Selon la nature de ces liaisons, ces phénomènes impliquent entre les atomes des échanges ou mises en commun d'électrons ou bien des forces électrostatiques. Les niveaux d'énergie mis en œuvre dans les phénomènes chimiques font que seuls les électrons périphériques sont concernés. Au-delà, on entre dans la physique des plasmas, voire dans la physique nucléaire avec l'implication du noyau atomique. Aux échelles inférieures à celle de l'atome, l'étude des particules élémentaires et de leurs interactions relève de la physique des particules.
    • Avec la biologie
      Il n'existe pas non plus de frontière clairement définie entre la chimie et la biologie. En effet, la délimitation n'est pas bien définie entre la biochimie, qui est la sous-discipline de la chimie qui étudie les réactions chimiques dans des milieux biologiques (cellules…) et/ou avec des objets biologiques (protéines et autres biomolécules…) et la biologie moléculaire qui est la sous-discipline de la biologie qui s'intéresse à la compréhension des processus biologiques au niveau moléculaire.
    • Avec la science des matériaux
      La chimie est omniprésente lorsqu'on considère les fondements du domaine initialement technologique des matériaux. Mais ce dernier tend à prendre par hyperspécialisation une distance envers sa matrice, et cette toile de fond n'apparaît souvent que lors des évolutions techniques. Ainsi l'art de la dentisterie en mutation dans les années 1980-1990 est largement tributaire des applications de la chimie macromoléculaire.
    L'évolution de la chimie, tant dans son enseignement que dans les champs de recherche, est influencée à terme par les puissantes directions de recherches américaines, en particulier de façon récente privilégiant majoritairement les domaines des soins et de la santé humaine et animale.
    La langue de la chimie est majoritairement l'anglais. Dès années 1880 à la Grande Guerre, l'allemand, l'anglais et le français ont pourtant été des langues véhiculaires nécessaires aux savants. Mais survient l'éclipse du français dans l'entre-deux-guerres. Puis l'allemand qui avait réussi à préserver quelques dernières revues importantes ou écrits scientifiques de référence a cédé face à la puissante organisation planétaire anglo-saxonne dans les années 1990.

    Concepts fondamentaux
    Structure de la matière
    - Élément
    Un élément est une entité immatérielle dénuée de propriétés physiques ou chimiques. C'est un couple formé d'un symbole et d'un numéro atomique (numéro d'ordre dans le tableau périodique des éléments) qui caractérise les atomes, molécules, ions, nucléides isotopes d'une espèce chimique donnée. Il existe 92 éléments naturels et 17 artificiels connus. Un élément chimique désigne abstraitement l'ensemble des atomes qui ont un nombre donné de protons dans leur noyau. Ce nombre est son numéro atomique. Par exemple, tous les atomes avec 6 protons dans leurs noyaux sont des atomes de l'élément carbone C. Ces éléments sont rassemblés et ordonnés dans le tableau périodique.

    - Atome
    L'atome (grec ancienἄτομος [atomos], «indivisible») d'une espèce chimique est une entité matérielle. Il est formé d'un noyau atomique contenant des nucléons, en particulier d'un nombre Z de charge électrique élémentaire positive du noyau qui maintient autour de lui un nombre d'électrons, charge négatives équilibrant la charge positive du noyau. Il possède un rayon, une structure géométrique, ainsi que des propriétés chimiques et physico-chimiques spécifiques relevant de ce cortège électronique.
    Un atome (du grec ατομος, atomos, "que l'on ne peut diviser") est la plus petite partie d'un corps simple pouvant se combiner chimiquement avec une autre. Il est généralement constitué d'un noyau composé de protons et de neutrons autour desquels orbitent des électrons. Sa taille caractéristique est de l'ordre du dixième de nanomètre (nm), soit 10^-10 m.
    La théorie atomiste, qui soutient l'idée d'une matière composée de "grains" indivisibles (contre l'idée d'une matière indéfiniment sécable), est connue depuis l'antiquité, et fut en particulier défendue par Démocrite, philosophe de la Grèce antique. Elle fut disputée jusqu'à la fin duXIX[SUP]e[/SUP] siècle, mais n'est plus aujourd'hui l'objet de la moindre controverse. C'est en particulier sur cette notion d'atome que reposent les sciences de la matière modernes. L'atome n'est cependant plus considéré comme un grain de matière insécable, depuis les expériences de physique nucléaire ayant mis à jour sa structure au début duXX[SUP]e[/SUP] siècle.
    En chimie, les atomes sont les éléments de base. Ils constituent la matière et forment les molécules en partageant des électrons. Les atomes restent grosso modo indivisibles au cours d'une réaction chimique (en acceptant les légères exceptions que constituent les échanges des électrons périphériques).

    Cependant, depuis le début duXX[SUP]e[/SUP] siècle, des expériences de physique nucléaire ont mis en évidence l'existence d'une structure complexe pour le noyau atomique. Les constituants de l'atome que sont des particules élémentaires.

    -- Isotope
    Un isotope d'une espèce atomique est une entité matérielle caractérisée par :

    • le symbole de son élément, le nombre Z qui est aussi le numéro atomique ;
    • le nombre de masse A qui représente la masse relative de l'isotope, A = Z + N.
    Un isotope possède des propriétés nucléaires spécifiques. Les propriétés chimiques des divers isotopes ne diffèrent pas entre elles pour les atomes suffisamment lourds.

    Les trois isotopes de l'hydrogène.
    L'hydrogène est le seul élément pour lequel on réserve un nom particulier
    à ses isotopes nettement plus massifs deutérium et tritium.


    [​IMG]

    Description : The three isotopes of the hydrogen cation (hydron).
    Date : 7 janvier 2010
    Source : Travail personnel
    Auteur : Mrgreen71
    Ce fichier est sous licence Creative Commons
    Paternité – Partage des conditions initiales à l’identique 3.0 Unported,
    2.5 Générique, 2.0 Générique et 1.0 Générique

    _____________________________

    - Molécule
    Une molécule est un assemblage précis d'atomes, domaine défini et structuré dans l'espace et le temps par des liaisons chimiques fortes. Une molécule polyatomique se comporte essentiellement comme une entité aux propriétés propres, une individualité chimique radicalement différente des atomes qui composent son architecture. Si les molécules monoatomiques ou les petites molécules polyatomiques sont électriquement neutres, les molécules plus grandes ou complexes n'obéissent pas systématiquement à ce critère.
    L'eau : Modèle éclaté simplifié de la molécule d'eau H[SUB]2[/SUB]O. Un atome d'oxygène arbitrairement en rouge s'est accolé deux atomes d'hydrogène arbitrairement en blanc. L'angle est respecté, mais non les tailles relatives des nuages électroniques.

    [​IMG]
    Cette œuvre a été placée dans le domaine public par son auteur, Benjah-bmm27.
    Ceci s'applique dans le monde entier.
    Dans certains pays, ceci peut ne pas être possible ;
    dans ce cas : Benjah-bmm27 accorde à toute personne le droit d'utiliser cette œuvre
    dans n'importe quel but, sans aucune condition, sauf celles requises par la loi.

    _____________________________

    - Liaison chimique
    La liaison chimique impliquant la présence d'électrons liés à un ou plusieurs noyaux explique la réalité moléculaire. Plus précisément elle assure la stabilité des molécules et dans le cas d'un assemblage complexe la cohésion liante de chaque atome entre eux, mettant en jeu par échange ou partage un ou plusieurs électrons dans les liaisons covalentes, par mise en commun d'électrons collectifs à un vaste réseau d'atomes dans la liaison métallique ou initiant par de fortes dissymétries locales de charges, des forces électrostatiques.

    - Corps pur
    Un corps pur est un corps généralement macroscopique constitué au niveau moléculaire d'une seule espèce chimique. Sa composition chimique, son organisation sous forme de gaz, liquide, solide amorphe ou réseaux cristallins...et ses propriétés physiques, par exemple les constantes physiques correspondant aux transitions de premier ordre comme la température de fusion, d'ébullition... peuvent être définies. En particulier, l'analyse chimique distingue les corps simples, dont l'espèce chimique est constituée d'atomes de mêmes éléments, des corps composés, dont l'espèce chimique est constituée d'atomes d'éléments différents.

    - Composé chimique
    Un composé chimique désigne l'espèce chimique d'un corps composé. Un corps pur est caractérisé par sa formule chimique, écriture symbolique qui peut être plus ou moins complexe et détaillée, de sa composition chimique. La masse molaire d'un corps pur correspond au nombre d'Avogadro de son espèce chimique ou simple molécule.

    - Ion
    Un ion est un atome qui a perdu ou gagné un ou plusieurs électrons. C'est un cation simple lorsque son cortège électronique a été privé d'un ou plusieurs électrons, il est chargé positivement. C'est un anion simple lorsque son cortège électronique est excédentaire, il est chargé négativement. Les anions ou cations formés à partir de molécules polyatomiques sont appelés ions complexes.
    - Complexe
    Les complexes sont des édifices formés par un élément central et des ligands. L'élément central est souvent un ion métallique et le complexe peut être chargé. Ils ont une grande importance en chimie des solutions et en catalyse.
    Un ion potassium complexé et inclus dans un cryptand. Les cryptands sont des molécules de synthèse comportant des cavités susceptibles de retenir et piéger un ion étranger. L'ensemble forme un cryptate, molécule complexe qui permet ainsi la dissolution de solides ioniques en solvant organique.


    [​IMG]

    Description : X-ray structure of K+ [2.2.2]cryptate. Original summary :
    "This is a picture generated from crystal structure data reported by Roger Alberto,
    Kirstin Ortner, Nigel Wheatley, Roger Schibli, and August P. Schubiger
    in the Journal of the American Chemical Society, Year 2001, Vol 123, Pages 3135-3136.
    It shows a potassium ion bound within a Cryptand[2.2.2].
    It was made by myself and is free to be used by all."

    Date : uploaded enwp at 00:28, 12 February 2007 (UTC) by en:User:M stone.
    Source : Image:Cryptand JACS 2001 3135.jpg.
    Auteur : User:M stone.
    Ce fichier est disponible selon les termes de la licence
    Creative Commons paternité – partage à l’identique 3.0 (non transposée)

    ________________________________

    Chimie réactionnelle
    - Réaction chimique
    Une réaction chimique est la transformation d’une ou de plusieurs espèces chimiques en d'autres espèces chimiques. Elle implique l'apparition ou la disparition d'au moins une liaison chimique ou un échange d'électron. La réaction qui possède des caractéristiques thermiques nécessite ou fait apparaître différentes formes d’énergie en rapport avec l'énergie de liaison chimique.

    - Solution et émulsion
    Une solution est un mélange homogène formé par un solvant en proportion majoritaire et d'un ou plusieurs solutés dans une phase homogène. La solubilité est la capacité d'un corps à entrer en solution dans un milieu donné. Par exemple un sel cristallin comme le chlorure de sodium NaCl ou sel de cuisine possède une limite de solubilité dans l'eau :357 g/kg d'eau à 0 °C et 391 à 100 °C. Cela signifie qu'à partir de cette teneur limite, il y a séparation de phase parce que le sel précipite ou se dépose sous forme solide.
    La miscibilité est la capacité d'un corps de se mélanger avec un autre en formant une seule phase. Le gaz ammoniac NH[SUB]3[/SUB] se mélange facilement à température ambiante avec l'eau liquide formant l'ammoniaque,1 kg d'eau froide saturée d'ammoniac peut contenir899 g de NH[SUB]3[/SUB]. Les gaz principaux de l'air oxygène et azote sont aussi miscibles en certaines proportions dans l'eau liquide.100 g d'eau liquide à 0 °C peut contenir au maximum4,89 cm[SUP]3[/SUP] du premier en solution et2,3 cm[SUP]3[/SUP] du second.
    Une émulsion est une dispersion d'une phase liquide à l'état de gouttelettes microscopiques ou submicroscopiques, dans une autre phase liquide non miscible. Une suspension est une dispersion d'une phase solide finement divisée au sein d'une autre phase liquide englobante. Pour qu'une suspension ou une émulsion soit stable, il faut que les fines gouttelettes ou les grains en suspension soient stabilisés par des molécules amphiphiles qui se placent à l'interphase, et ainsi il n'y a ni coalescence des gouttelettes ni agglomérations de particules solides. Mais il faut noter, avec le rigoureux chimiste et gastronome moléculaire, Hervé This, que l'immense majorité des systèmes culinaires ne sont pas des émulsions : ce ne sont que des dispersions colloïdales plus ou moins complexes.
    L'art, à l'origine souvent empirique, de fabriquer des dispersions colloïdales a fourni des applications en pharmaceutique comme en cuisine, par exemple pour la préparation de chocolats et glaces, de sauces ou de mayonnaises.

    - Oxydo-réduction et électrochimie
    Une réaction d'oxydo-réduction met en jeu une perte ou un gain d’électron entre différents couples d'espèces chimiques. Une espèce d'un corps chimique ayant la capacité d’arracher des électrons à d’autres corps chimiques est appelée oxydant. De la même façon, une espèce d'un corps chimique capable de donner des électrons à un autre est appelée réducteur.
    Schéma simplifié d'une pile volta. Les piles sont une des applications communes de l'électrochimie

    - Acide et bases
    Les réactions acides-bases en solution sont basées aussi sur des couples d'espèces chimiques. L'acidité et la basicité peuvent être calculées ou mesurées par la concentration des espèces chimiques en solution, qui prennent une forme acide ou base. Svante Arrhenius a mis en évidence dans les solutions aqueuses l'échange de protons entre les composés chimiques, la concentration en ion hydronium indique l'acidité du milieu comme la concentration en ion hydroxyle la basicité. Une extension de la modalité de classification à d'autres milieux solvants a été conduite par le chimiste américain Gilbert Newton Lewis.

    Unités propres à la chimie
    - Mole
    Le nombre de molécules participant à une réaction chimique est très élevé : il est dès l'emploi de quelques dizaines de grammes de matière proche du nombre d'Avogadro, donc de l'ordre de 6,02 10[SUP]23[/SUP].
    Les chimistes utilisent communément une unité numérique, la mole, qui est représentée par la lettre minuscule «n». Une mole d'une entité chimique moléculaire précise implique mathématiquement l'égalité du nombre de ses molécules identiques au nombre d'Avogadro. Ce dernier nombre est défini par convention comme le nombre d'atome de carbone présents dans12 grammes de carbone 12, c'est-à-dire, un atome de carbone contenant six neutrons et six protons.
    Une mole de gaz parfait occupe dans les conditions normalisées de pression (101.3 kPa) et de température (0 °C ou 273 K)22,4 litres. L'estimation de la masse molaire M d'un corps pur est facile en connaissant sa formule chimique. Une mole de ce corps pur désigne simplement le nombre d'Avogadro de molécules identiques de ce corps pur.


    Chimie organique
    - Polymères
    Les polymères sont des grandes molécules ou macromolécules dont un grand nombre des plus communs est formé par la réaction en chaine de petites molécules appelées monomères. Ces polymères de synthèse industriels, dont la structure est fondée sur la réplication d'un motif organique de base peuvent être linéaires, ramifiés ou greffés, en réseau ou interpénétrés... Dans le cas de polymères formés par polyaddition de monomères organiques dont le site réactif est justement la double liaison carbone-carbone, le grand squelette plus ou moins souple formé d'atomes de carbone qui est décrit par ses configurations et longueur(s) de chaine moyenne(s) influence les propriétés observées. Citons parmi ces polymères organiques, les polyéthylènes, les polypropylènes, les polystyrènes, les polyisoprènes, les polybutadiènes, les PVC, les polyacryliques... Il existe d'autres sortes de réactions de polymérisations, comme les polycondensations à l'origine des polyesters, polyamides, polycarbonates, polyuréthanes. Il existe aussi des polymères à motifs minéraux, comme les silicones ou les polysufures.
    Comme le pionnier Hermann Staudinger le pressentait en 1910, il existe des macromolécules ou polymères naturels, par exemple à base-motif de glucose ou sucre chimique comme la cellulose ou l'amidon, à base-motif d'acides aminés comme les protéines et ADN. La chimie macromoléculaire née dans les années trente a été un domaine continument innovateur, même au cours des dernières décennies.


    Chimie expérimentale

    La chimie expérimentale assure essentiellement quatre fonctions :

    • Extraire, c'est-à-dire séparer sélectivement un ou plusieurs composés d'un mélange sur la base de leurs propriétés chimiques ou physiques ;
    • Synthétiser, c'est-à-dire mettre en œuvre un ensemble de réactions chimiques en vue d'obtenir un ou plusieurs produits ;
    • Purifier, c'est-à-dire isoler une substance sélectionnée des autres composés d'un mélange, considérés comme impuretés ;
    • Analyser, c'est-à-dire reconnaître et caractériser des substances connues ou inconnues.
    Lois chimiques

    La chimie, science expérimentale et descriptive, prenant un essor remarquable à l'époque industrielle tout en acceptant la modélisation physique et le langage mathématique là où ils étaient pertinents, a découvert ou ouvert la voie à nombreuses lois physico-chimiques.



    SUITE ...


     
  3. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113
    Suite .... Chimie
    ______________________________________________________________________


    Industrie

    L'industrie chimique se développe continûment à la fin du siècle des Lumières. Si la métallurgie n'est pas oubliée, le progrès est partout observable. Le fer blanc devient un produit commun entre 1770 et 1780. Puis après 1780, outre les métaux, elle mêle des fabrications millénaires à des innovations récentes : les acides et la soude, l'ammoniac, le chlore et les chlorures décolorants, le phosphore et ses dérivés, les savons et acides gras, l'hydrogène, l'éther, l'éthylène, l'alcool de vin, l'acide acétique et surtout de nombreux sels et une multitude de dérivés organiques et minéraux préparés ou recueillis dans un cadre traditionnel.

    Elle prend un essor prodigieux au XIX[SUP]e[/SUP] siècle et participe pleinement aux fortes mutations de la révolution industrielle. Le gaz d'éclairage, produit de la distillation de la houille ou charbon gras, lance l'immense développement de la carbochimie. La découverte de métaux, leurs préparations au laboratoire, puis au stade industriel, ainsi en-est-il de l'aluminium et des métaux alcalins et alcalino-terreux, témoignent de la vigueur de la science très proche de l'industrie.

    En 1900, usines et laboratoires fabriquent déjà dans le monde plus de 100 000 composés, mettant en œuvre des centaines de réactions chimiques types. Chercheurs et institutions savantes décrivent et référencent procédés, réactions et molécules.
    L'industrie chimique représente une part importante de l'activité économique des grands pays industriels au XX[SUP]e[/SUP] siècle. Dans les années 1970, elle intéresse au sens large la moitié du capital industriel mondial. La variété des matériels et des technologies qu'elle utilise est incroyablement vaste, comme l'indique une visite au pas de course des exposants pendant les jours de l'Achema à Francfort.


    Parmi les activités chimiques, retenons les secteurs suivants :

    • métallurgie :
      • métallurgie qui transforme les minerais en métaux et en alliages, fonderies métalliques ;
      • métallurgie de spécialités, silicium, matériaux semi-conducteurs ;
      • aimants, conducteurs et matériaux pour turbines
    • électrochimie :
      • piles, batteries, électrochimie appliquée ;
      • traitement de surface, galvanoplastie ;
    • matériaux :
      • plâtre, chaux, ciments et mortiers ;
      • matériaux réfractaires et technologie des fours ;
      • verres, argiles et céramiques, faïences et porcelaine ;
      • pigments et charges minérales, émaillerie ;
    • industrie du bois-papier et cellulose, couchage du papier ;
    • raffinage du sucre ;
    • chimie organique :
      • acides gras, corps gras et savons ;
      • chimie des substances naturelles, chimie médicale et pharmaceutique ;
      • parfums, huiles essentielles, produits cosmétiques ;
      • engrais, chimie agricole, explosifs ;
      • ligneux, bois, charbons et pétroles, combustibles, mais aussi matières premières pour la carbochimie et la pétrochimie. Ci-dessous souvent présentes en tout ou partie :
        • lubrifiants, graisses, produits à propriétés tribologiques ;
        • colorants, intermédiaires de réactions photochimiques ;
        • macromolécules, polymères, plastiques et thermodurcissables ;
    • peinture, vernis :
      • traitement de fibres textiles, apprêt et teinture
      • détergents, agents de surface, produits décapants ou de nettoiement, adoucissants des eaux ;
      • produits phytosanitaires, insecticides, herbicides ;
      • médicaments, antibiotiques.
    Cette industrie peut se scinder en deux grands types :

    L'ampleur de la production chimique caractérise la «chimie lourde» ou bulk chemistry avec ses procédés automatisés et ses énormes masses traitées ou extraites. La «chimie fine» se limite à des quantités restreintes de composés, souvent à haute valeur ajoutée pour la pharmacie, la parfumerie et la cosmétique ainsi que dans de nombreux domaines ciblés de haute technologie ou nano produits. (Voir ici: http://www.wladbladi.net/forum/bibliotheque-wladbladi/120054-nanotechnologies.html#post1333625 )

    La chimie a permis d'accéder à de nouveaux matériaux, métaux, plastiques, ou céramiques qui ont des applications importantes dans notre vie la plus quotidienne. Les progrès chimiques ont permis de synthétiser directement certains médicaments au lieu de les extraire des plantes.

    Recherche
    Un monde de la recherche
    Si les approches supposées définir la chimie dans les différentes parties de cet article semblent bizarres à un chimiste - et en effet, avec la forte imprégnation d'une vision scolastique s'y esquisse l'épistémologie, l'histoire, la didactique, l'enseignement, les rapports au grand public... à défaut d'une sociologie apparente de la science chimique, bref, tout sauf de la chimie - induisant des images avortées aux yeux du spécialiste, c'est que la chimie n'existe véritablement que dans le flux de la recherche. Cette science s'actualise, au jour le jour et depuis plusieurs siècles, par la manipulation à la paillasse ou avec l'instrumentation la plus sophistiquée, affine ses modèles mois après mois, laissant des résultats qui, années après années, modifient insensiblement et irréversiblement les pensées sur la matière. Et ce champ se construit sur des thèmes choisis, imposés ou dérivés au point qu'un constat humoristique en partie extérieur, par exemple celui du physicien Pierre-Gilles de Gennes, pouvaient la qualifier d'une fabuleuse réunion d'auberges espagnoles.

    Lieu de vie et de labeur hiérarchisé et segmenté, le laboratoire laisse entrer de nombreux thèmes imposés par la société. En premier lieu, en quête de budgets pour sa subsistance économique, il laisse venir les besoins et les impératifs de l'industrie, marquant dans le meilleur des cas ses résultats par des prises de brevets conjointes avec le donneur d'ordre. Ne rejetant pas les références institutionnelles pour sa nécessaire existence publique ou médiatique, il est flatté des demandes officielles et sa reconnaissance dans les domaines de l'expertise, de l'encadrement et de la formation couronne son existence.

    Mais pour les meilleurs chercheurs au sein des organisations efficacement gérées ou privilégiées, les thèmes dérivés s'imposent, car compréhension des découvertes et course à l'invention les font entrer dans une captivante émulation si l'ardeur reste scientifique ou une féroce concurrence si elle se mâtine de gains économiques ou de monopoles, souvent pédagogiques ou d'expertise, par le soutien politique.

    Henri Poincaré citait souvent l'analogie suivante : «La science se construit sur des faits et des données d'expérience comme une maison se bâtit avec des pierres et divers matériaux». Mais, précisait-il aussitôt, «une collection de faits et un amalgame de savoirs ne sont pas plus une science que des tas de moellons et de bois une bâtisse».

    La laborieuse entreprise collective qu'est la science appelle impérieusement une minorité de chercheurs, au minimum quelques centièmes, plus ou moins écoutés selon les moments, à défendre les thèmes fondamentaux et à définir par leurs écrits et conférences, les acquis et les applications de leurs disciplines. Ces chercheurs puristes ou engagés s'acharnent à poursuivre l'enquête scientifique au sens noble, soucieux de description, de fiabilité des mesures, de réitération et de recherches complémentaires sur des sujets moins à la mode, mais selon eux fondamentaux. Ces modestes opérateurs collectifs de la gigantesque maîtrise d'œuvre collective qu'est la science comptent parmi eux les ardents défenseurs d'une libre éthique de vérité scientifique, les divers piliers et dirigeants des comités de revues ou des associations, sociétés ou académies, les réformateurs ou micro-adaptateurs inlassables de la nomenclature en vigueur. Au-delà des fronts avancés ou des champs d'applications où accourent la foule des chercheurs en lutte pour s'imposer à leurs semblables, la chimie leur doit sa cohérence et son label scientifique.

    Même dans la description de la chimie la plus authentique, l'écueil d'un aperçu sociologique ne peut être évité que par l'anecdote et l'histoire d'abord personnelle d'une recherche. Ainsi Johnson chimiste du Middle West américain émule de Wendel Meredith Stanley définissait la naissance de sa recherche en chimie organique comme le fruit né de la contemplation puis de l'observation raisonnée des feuilles mortes de sa ville. C'est ce simple déchet végétal collecté, puis transformé en compost, par dégradation microbienne et action des levures et champignons, puis recyclé en terre dans les jardins ou autres lieux d'épandage, qui est à l'origine de sa vocation. La chimie ici ne peut se dissocier de la formidable action chimique du vivant et, tôt ou tard remise dans une large perspective évolutive prenant en compte les paramètres physico-chimiques, des multiples «inventions» du vivant sous toutes les latitudes et dans tous les milieux. Tant il est vrai que l'étude précise d'une petite fraction d'un cycle terrestre débouche sur l'attrait d'en savoir plus et de poursuivre l'enquête. D'une manière analogue, on ne peut comprendre les débats de la chimie stellaire que par l'attrait initial des composants intimes des atomes et molécules induisant une course à leur origine.


    Applications et toxicologie

    La chimie est à l'œuvre partout dans la nature, les corps vivants, les choses de la vie quotidienne sans que l'observateur attentif et disposant de puissants multiplicateurs sensoriels ne puisse correctement l'imaginer ou le modéliser. Un chimiste est dès l'origine un expert des bilans matière et énergie et il sait intuitivement qu'il devrait prendre en compte tous les milieux et les acteurs microbiologiques, végétaux, animaux et humains. Lui en laisse-t-on les moyens ?

    De la chimie en bien et en mal
    Citons quelques applications. D'abord la mesure. L'analyse précise de solutions diluées dans un solvant, contenant des molécules solubles plus ou moins complexes, est le fruit de longues mises au point analytiques, aujourd'hui très vite réalisées et banales, comme en chimie des solutions aqueuses. Pensons aux analyses banalisées de l'eau de notre robinet reconnue potable ou des eaux minérales du commerce. Les (bio) chimistes spécialistes des eaux ont un rôle de surveillance des eaux naturelles et de leurs qualités ou toxicités éventuelles. Si les progrès substantiels avaient été réalisés, le recours à la désinfection chimique de l'eau du robinet avant consommation pourrait être modéré. En fin d'usage, la maîtrise des procédés chimiques et biologiques permet le traitement des eaux usées dans les stations d'épuration.

    Ensuite l'usage. La chimie la plus simple peut commencer avec la fabrication et l'usage du sel, nécessaire à l'alimentation et capital pour les vieux procédés de longues conservations des aliments.

    Aujourd'hui les produits de l'industrie agro-alimentaire ont recours à une gamme plus variée de conservateurs, agents de conservation ou agents nutritif, additifs alimentaires comme les colorants, les arômes artificiels, les édulcorants...

    Des emballages alimentaires à la préservation des récoltes, une connaissance raisonnée des matériaux et des aliments permet d'éviter le gaspillage et les déperditions tout en préservant la qualité et propriétés nutritionnelles des futurs aliments. Suivant l'usage, les emballages peuvent être biodégradables et, à l'aide du tri sélectif après utilisation, ils sont transformés et revalorisés grâce à des procédés chimiques de recyclage ou une combustion ultime qui permet de ne pas gaspiller l'énergie qu'ils recèlent.

    L'agriculture a subi une mutation technologique et elle est devenue fortement dépendante d'intrants chimiques. Il est certain que l'utilisation à grande échelle d'engrais chimiques, l'usage irraisonné de pesticides et d'insecticides dans des monocultures de plus en plus sensibles ou fragiles peuvent être une impasse désastreuse à long terme pour les sols, l'écologie des terres et la santé des animaux et des hommes qui y vivent ou vivront, ainsi que les tenants de l'agriculture biologique le postulent dans l'immédiat. Si on donne à un homme un couteau, il peut découper finement un jambon de façon à le partager avec ses amis, ou encore égorger sauvagement ses voisins perçus en ennemis. L'utilisation des technologies chimiques recèle des bienfaits potentiels ou de terribles dangers selon les usages ou les buts visés.

    Elle échappe autant aux chimistes qu'à l'honnête homme de la rue. Par exemple, un chimiste organicien considère comme une absurdité de brûler de l'essence dans un moteur à combustion, car pour lui cette matière de choix permet de réaliser d'autres molécules chimiques à usage variés qui, alors seulement au terme de leur usage, pourraient être décomposées et brûlées. Le gain sur une courte échelle de temps d'une famille de produits chimiques, parfois peu sophistiqués et à utilisation massive, permet d'obtenir des profits évidents. Ainsi s'obtiennent des récoltes plus abondantes en enrichissant les sols pauvres et en éliminant les insectes nuisibles, les champignons parasites, les mauvaises herbes et la faune associée. Mais qu'en est-il à longue durée ? Après l'éradication de multiples espèces d'oiseaux, l'affaiblissement des hyménoptères butineurs, n'est-il pas temps d'une prise de conscience générale des dommages causés à l'environnement ?

    Les sociétés agrochimiques produisent alors de nouveaux produits plus efficaces ou plus ciblés qui peuvent soit respecter mieux l'environnement soit entraîner d'autres catastrophes parfois plus pernicieuses alors que la course au profit immédiat implique de minorer toute information alarmiste.

    La chimie explique sommairement la formation du bois et des textiles naturels ou permet la synthèse de larges gammes de matières et de types de matériaux : textile synthétique (comme le nylon, le lycra et la fibre PVC dite polaire), mobilier en matière plastique, etc.

    Dans le domaine de la construction, la chimie a beaucoup évolué en contribuant aussi à la fabrication de matériaux, d'isolants performants, de peintures ou de vernis, de mastics, de produits d'entretien et d'ameublement. Les désagréments causés par les produits des premières générations ont été très lentement corrigés, puis les générations suivantes apportent d'autres inconvénients.

    Un nombre important d'applications chimiques ont trouvé ou trouvent encore des débouchés et usages commerciaux profitables, alors qu'une connaissance approfondie et précise des méfaits de leurs emplois ou mésusages fait défaut tant aux utilisateurs qu'au public. La chimie toxicologique est une parente pauvre et alors que les grands groupes pétrochimiques se sont vantés dans les années 1970 d'apporter une sécurité écologique, les 200 000 molécules que leurs activités ont permis de confectionner ne sont véritablement connues du toxicologue qu'à 1 %. Le progrès n'est plus visible depuis longtemps, c'est un chamboulement, un gain éhonté pour certains, une menace vitale pour les moins favorisés, mais comment essayer de maîtriser et de juguler le danger sans faire confiance à la collégialité de différents chimistes, renforcées au besoin d'équipes expertes de mathématiciens, physiciens, de biologistes... et à leurs éthiques de vérité scientifique ?
    Santé et environnement
    La découverte et la synthèse de médicaments qui contribue à l'augmentation de l'espérance de vie enregistrée depuis la fin de la révolution industrielle dans les pays développés sont aussi à l'actif des techniques de la chimie. Mais la médicalisation massive d'une population entraîne d'irréductibles problèmes de pollutions, car les molécules ou leurs produits sommaires de dégradations se retrouvent dans les eaux usées.

    Dans le domaine «Santé-Environnement», la chimie constitue une source de problème via certains polluants qu'elle crée ou contribue à diffuser dans l'environnement, en particulier les produits chimiques toxiques ou écotoxiques dont les CMR «cancérigènes, mutagènes, reprotoxiques». Certains produits tels que médicaments, pesticides, catalyseurs ou leurs résidus perdus dans l'environnement ou présents dans l'alimentation peuvent ensuite poser des problèmes d'environnement ou de santé, en particulier avec les perturbateurs endocriniens).

    Les substances chimiques seraient «au premier rang des accusés» de la chute de la qualité des spermatozoïdes (réduite de 50 % depuis 1950) et des maladies liées à l'appareil génital à travers les perturbateurs endocriniens. Le 25 novembre, le gouvernement français (à travers l'Iresp, structure de recherche créée par l'INSERM et 20 partenaires) et l'Afsset) a organisé un colloque sur ce thème: «Environnement chimique, reproduction et développement de l'enfant.» Les principales matières incriminées sont les phtalates et le bisphénol A, deux additifs présents dans les matières plastiques.

    Risques et réglementation
    Au niveau international, la convention de Rotterdam, administrée par l'ONU (PNUD, FAO) a été adoptée par 165 pays en 1998 pour mieux assurer la santé des personnes et de l’environnement contre des dommages éventuels induits par le commerce de produits chimiques.
    De nombreuses législations concernent les produits chimiques et leurs résidus, qui varient selon les pays. Des bases de données et guides sur le risque chimique existent, dont en France.


    La chimie fantasmée


    Le chimiste apparaît souvent en personnage caricatural de la littérature, de la bande dessinée et surtout du cinéma. Ces savants échevelés ou docteurs désopilants, à la fois et confusément biologistes, chimistes et physiciens, sont des êtres sourds au monde vrai ou perdus hors du laboratoire et de l'étude, à moins de remonter le temps, d'aller dans un autre monde ou sur la Lune, à l'image du professeur Tournesol. Ils interviennent surtout de façon intermittente, leur action est tantôt décisive tantôt inquiétante car elle oriente la fiction.
    Dans un registre comique, alliant de façon classique la chimie et l'amour, citons Jean Lefebvre jouant le rôle d'Eugène Ballanchon dans Le Fou du labo 4, film de Jacques Besnard de 1967.

    Littérature
    La représentation littéraire du chimiste dans de nombreuses œuvres est très différente de la réalité. Il est considéré comme un savant venu d'ailleurs qui vit hors du temps. Le chimiste est alors un demi-sorcier, image issue de l'ancien alchimiste, qui joue avec des forces obscures qu'il ne maîtrise pas afin de rivaliser avec la nature. La chimie est souvent associée avec l'occulte alors qu'elle est une science reconnue.
    Il faut toutefois soustraire à ce noir tableau Le Système périodique de Primo Levi. Cet ouvrage littéraire italien sur le thème de la chimie comporte vingt-et-un chapitres qui, chacun séparément, illustre un élément du tableau de Mendéléiev. Ces parties descriptives qui ont été conçues avec le support spatial du tableau périodique et l'art du chimiste relatent au besoin la vie professionnelle de l'écrivain, par ailleurs chimiste spécialiste de peinture et directeur du laboratoire d'une petite unité de production à Turin, des anecdotes ou rencontres autobiographiques ou de courtes nouvelles complémentaires inventées, judicieusement choisies.
    Citations

    • «En sentiment comme en chimie, rien ne se crée, rien ne se perd», Alfred Capus, Les pensées
    • «Rien ne se perd, rien ne se crée, tout se transforme», Lavoisier
    Enseignement

    Le laboratoire est souvent le meilleur endroit de formation à cette science expérimentale, mais il nécessite des moyens coûteux, une lourde surveillance et une organisation souvent disproportionnée pour un usage souvent trivial.

    France
    L'enseignement, du moins en France, se borne souvent au niveau élémentaire et, dans le meilleur des cas, à une didactique de la chimie.
    En 2009 en France, la chimie est enseignée à partir du collège en même temps que la physique dès la cinquième à raison d'une heure et demie en moyenne, par semaine.

    Ensuite, au lycée, les élèves commencent par avoir trois heures et demie de physique-chimie par semaine dont une heure et demie de travaux pratiques en seconde. La poursuite de l'enseignement de la chimie dépend du choix d'orientation des élèves : jusqu'en première uniquement pour les élèves des filières littéraires et économico-sociales ; et jusqu'en terminale pour les élèves des filières scientifiques, STL, STAV et ST2S.

    Enfin, la chimie peut être étudiée après le baccalauréat en CPGE, en UFR de chimie (université), en IUT de chimie (université) ou en école de chimie. De nombreuses écoles d'ingénieurs dans le domaine de la chimie sont regroupées au sein de la fédération Gay-Lussac.

    Québec
    En 2009 au Québec, les cours de chimie et de physique sont des options que peut prendre l'élève de cinquième secondaire, poussant plus loin le cours de «sciences et technologie» qu'il a été obligé de suivre durant les dernières années de son secondaire. En temps normal, pour être admis dans les cours de chimie et de physique de cinquième secondaire, les élèves doivent avoir suivi avec succès le cours de «sciences et technologie de l'environnement» en quatrième secondaire. Les options de chimie et de physique servent comme critère d'admission dans plusieurs programmes du cégep comme les cours de sciences pures et appliquées, de sciences de la nature et de sciences de la santé.

    Suisse
    En 2009 en Suisse, la chimie est enseignée au gymnase dès la dixième année de scolarité. Les universités de Bâle, de Genève, de Berne, de Fribourg et de Zurich forment des chimistes et les écoles polytechniques, comme l'École polytechnique fédérale de Lausanne, des ingénieurs chimistes et des chimistes.

    Bibliographie
    Institutions ou associations nationales

    Prix

    Quelques personnalités de la chimie et de la physico-chimie

    [​IMG]

    ___________________________
    Nom de la page : Chimie
    Contenu soumis à la licence CC-BY-SA 3.0.
    Source : Article Chimie de Wikipédia en français (auteurs)
    Les textes sont disponibles sous
    licence Creative Commons paternité partage à l’identique

    ___________________________


    VOIR AUSSI/

    La chimie au lycée, sur le site du CNRS
    Ressources en Chimie - site Ecole Normale Supérieure-DGESCO
    Société Française de Chimie (SFC)
    Chimedit Les ressources de la chimie
    Société Suisse de chimie (SSC)
    (en) Eric Weisstein's world of chemistry
    Expériences de chimie amusante sur scienceamusante.net
    La chimie pour tous
    La Chimie.net - cours et support didactique pour l'apprentissage de la chimie (niveau secondaire : collège & lycée)
    Les Signets de la Bibliothèque nationale de France (sélection de sites web sur la chimie dans le répertoire encyclopédique)
    (fr) (en) (de) Chimie générale on-line (site destiné aux étudiants en sciences de la vie développé par les universités de Lausanne, Genève, Fribourg et Neuchâtel, ainsi que l'EPFL sous l'égide du Campus virtuel suisse)




    A SUIVRE / ATOME
     
  4. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113

    Atome



    [​IMG]

    Description : Représentation d'un atome d'hélium 4 avec, apparaissant rosé au centre,
    le noyau atomique et, en dégradé de gris tout autour, le nuage électronique.
    Le noyau d'hélium 4, agrandi à droite, est formé de deux protons et de deux neutrons.
    Date : 15 June 2007 à 10:38
    Source : Travail personnel
    Auteur : User:Yzmo
    Ce fichier est disponible selon les termes de la licence
    Creative Commons paternité – partage à l’identique 3.0 (non transposée).

    ______________________________________


    Un atome (grec ancienἄτομος [atomos], «qui ne peut être divisé») est la plus petite partie d'un corps simple pouvant se combiner chimiquement avec une autre. La théorie atomiste, qui soutient l'idée d'une matière composée de «grains» indivisibles (contre l'idée d'une matière indéfiniment sécable), est connue depuis l'Antiquité, et fut notamment défendue par Leucippe et son disciple Démocrite, philosophes de la Grèce antique. Elle fut disputée jusqu'à la fin du XIX[SUP]e[/SUP] siècle et n'a plus été remise en cause depuis lors. C'est ainsi sur les propriétés des atomes que reposent toutes les sciences des matériaux modernes.

    Un atome est constitué d'un noyau concentrant plus de 99,9 % de sa masse, autour duquel se distribuent des électrons pour former un nuage 40 000 fois plus étendu que le noyau lui-même. Ce dernier est constitué de protons, chargés positivement, et de neutrons, électriquement neutres ; l'hydrogène fait exception, car le noyau de son isotope [SUP]1[/SUP]H, appelé protium, ne contient aucun neutron. Les électrons occupent des orbitales atomiques en interaction avec le noyau via la force électromagnétique, tandis que les nucléons sont maintenus ensemble au sein du noyau par la liaison nucléaire, qui est une manifestation de l'interaction nucléaire forte. Le nuage électronique est stratifié en niveaux d'énergie quantifiés autour du noyau définissant des couches et des sous-couches électroniques ; les nucléons se répartissent également en couches nucléaires, bien qu'un modèle approché assez commode popularise la structure nucléaire d'après le modèle de la goutte liquide.

    Plusieurs atomes peuvent établir des liaisons chimiques entre eux grâce à leurs électrons, et, d'une manière générale, les propriétés chimiques des atomes sont déterminées par leur configuration électronique, laquelle découle du nombre de protons de leur noyau. Ce nombre, appelé numéro atomique, définit un élément

    Structure
    Ordres de grandeur
    Le diamètre estimé d'un atome «libre» (hors liaison covalente ou cristalline) est compris entre 62 pm (6,2×10[SUP]-11[/SUP] m) pour l'hélium et 596 pm (5,96×10[SUP]-10[/SUP] m) pour le césium, tandis que celui d'un noyau atomique est compris entre 2,4 fm (2,4×10[SUP]-15[/SUP] m) pour l'isotope [SUP]1[/SUP]H et 14,8 fm (1,48×10[SUP]-14[/SUP] m) environ pour le nucléide [SUP]238[/SUP]U: le noyau d'un atome d'hydrogène est donc environ 40 000 fois plus petit que l'atome d'hydrogène lui-même.

    Le noyau concentre cependant l'essentiel de la masse de l'atome: le noyau du lithium 7, par exemple, est environ4 300 fois plus massif que les trois électrons qui l'entourent, l'atome de [SUP]7[/SUP]Li lui-même ayant une masse de l'ordre de1,172×10[SUP]−26[/SUP] kg. Pour fixer les idées, la masse des atomes est comprise entre1,674×10[SUP]-27[/SUP] kg pour le protium et3,953×10[SUP]-25[/SUP] kg pourl'uranium 238, en s'en tenant aux isotopes qui ont une abondance significative dans le milieu naturel (il existe des noyaux plus lourds mais aussi bien plus instables que le nucléide [SUP]238[/SUP]U).

    Cette masse est généralement exprimée en unités de masse atomique («uma», ou «u»), définie comme la douzième partie de la masse d'un atome de [SUP]12[/SUP]C non lié et à son état fondamental, soit1 uma = 1,66054×10[SUP]-27[/SUP] kg ; dans cette unité, la masse du nucléide [SUP]238[/SUP]U vaut238,0507826 uma. Une unité alternative également très employée en physique des particules est l'électron-volt divisé par le carré de la vitesse de la lumière (eV/c[SUP]2[/SUP]), qui est homogène à une masse en vertu de la fameuse équation E = mc [SUP]2[/SUP] de la relativité restreinte, et qui vaut1 eV/c[SUP]2[/SUP] = 1,783×10[SUP]-36[/SUP] kg ; dans cette unité, la masse du noyau [SUP]238[/SUP]U est égale à221,7 GeV/c[SUP]2[/SUP].

    Compte tenu de leur taille et de leur masse singulièrement réduites, les atomes sont toujours en très grand nombre dès qu'on manipule une quantité de matière macroscopique. On définit ainsi la mole comme étant la quantité de matière constituée par autant d'unités élémentaires (atomes, molécules, électrons, etc.) qu'il y a d'atomes dans12 g de carbone 12, soit pas moins de 6,022×10[SUP]23[/SUP] unités élémentaires, ce qu'on appelle le nombre d'Avogadro.

    Particules subatomiques
    Bien que son étymologie signifie «indivisible» en grec ancien, un atome est en réalité constitué de particules élémentaires plus petites, et peut donc être divisé ; mais il constitue bien la plus petite unité indivisible d'un élément chimique en tant que tel : en brisant, par exemple, un atome d'hélium, on obtiendra des électrons, des protons et des neutrons, mais on n'aura plus un corps simple ayant les propriétés de l'hélium.


    • Le proton p[SUP]+[/SUP] est 1 836 fois plus massif que l'électron (1,6726×10[SUP]−27[/SUP] kg, soit 938,27 MeV/c[SUP]2[/SUP]) avec une charge électrique positive de même valeur absolue que celle de l'électron (1,602×10[SUP]−19[/SUP] C).

    • Le neutron n[SUP]0[/SUP] est 1 838,5 fois plus massif que l'électron (1,6749×10[SUP]−27[/SUP] kg, soit 939,57 MeV/c[SUP]2[/SUP]), et est électriquement neutre.
    Le modèle standard de la physique des particules décrit les nucléons comme des baryons composés de particules élémentaires appelées quarks :


    Les électrons, quant à eux, sont des leptons, qui constituent, avec les quarks, le groupe des fermions. La grande différence entre quarks et leptons est que seuls les premiers connaissent toutes les interactions élémentaires, y compris l'interaction nucléaire forte, dont les médiateurs sont des bosons de jauge appelés gluons ; les leptons ne connaissent que l'interaction faible (via les bosons Z[SUP]0[/SUP] et W[SUP]±[/SUP] ) et l'interaction électromagnétique (via les photons).
    Toutes ces particules connaissent a priori également l'interaction gravitationnelle, mais cette dernière n'a pas encore pu être intégrée au modèle standard de la physique des particules ; son intensité à l'échelle atomique est, quoi qu'il en soit, insignifiante comparée à l'intensité des trois autres interactions.

    Nuage électronique
    L'essentiel des propriétés physiques et chimiques des atomes est dû à leur nuage électronique. C'est la compréhension de la nature et de la structure de ce nuage électronique qui a ouvert la voie à la compréhension de la structure de l'atome lui-même et, in fine, a conduit au développement de la physique des particules.

    Le noyau atomique étant chargé positivement, il forme un puits de potentiel pour les électrons, qui sont chargés négativement. Ce puits de potentiel est constitué de niveaux d'énergie définis par des nombres quantiques dont la combinaison détermine des orbitales atomiques conférant aux fonctions d'onde correspondantes des dimensions et des formes caractéristiques.


    - Introduction au modèle de Schrödinger
    L'électron manifeste, comme tout objet quantique, une dualité onde-corpuscule, en vertu de laquelle il se comporte tantôt comme une particule géométriquement délimitée occupant une position déterminée, tantôt comme une onde susceptible de présenter, par exemple, des phénomènes d'interférences. Ces deux aspects de l'électron coexistent dans l'atome, bien que le modèle de Schrödinger soit exclusivement ondulatoire :

    • un électron n'est jamais localisé à un endroit précis d'une trajectoire définie autour du noyau, mais distribué au sein d'une orbitale atomique avec une probabilité de présence égale au carré de la norme de sa fonction d'onde, laquelle est corrélée à son état quantique, ainsi qu'avec une phase d'électron : c'est l'aspect ondulatoire.

    • cette distribution n'est pas statique, mais dynamique, en ce que l'électron est pourvu, au sein de son orbitale atomique stationnaire, d'une quantité de mouvement et d'un moment angulaire orbital : c'est l'aspect corpusculaire.
    · Par conséquent, un électron ne peut pas «tomber sur le noyau» comme un objet tombe par terre, car cela signifierait que l'extension spatiale de sa fonction d'onde serait réduite à un point, ce qui n'est le cas d'aucune fonction propre de l'équation de Schrödinger : cette dernière impose, au contraire, qu'un électron, au voisinage du noyau, se « dilue » dans un volume (une orbitale) à la géométrie déterminée par les nombres quantiques qui satisfont cette équation. On peut donc considérer qu'un électron dans un atome est déjà tombé sur le noyau, dans la mesure où il est confiné dans son voisinage par le puits de potentiel électrostatique.

    · De surcroît, la fonction d'onde d'un électron n'est pas nulle à l'intérieur du noyau, bien que sa probabilité de s'y trouver soit faible, car le noyau est de taille très réduite comparée à celle des orbitales atomiques. Les fonctions d'ondes possibles pour les électrons d'un atome étant centrées sur le noyau, on peut donc dire que l'électron est en fait tombé dans le noyau, bien qu'il ne s'y trouve que très rarement : du point de vue quantique, plusieurs particules peuvent en effet occuper le même espace en vertu de leur nature ondulatoire. Une façon imagée — mais approchée — de voir les choses est d'imaginer, par analogie, que la fonction d'onde de l'électron serait comme «diffractée» par le noyau atomique, ce qui lui donnerait différentes formes, selon son état quantique, par lesquelles la probabilité de présence de l'électron atteindrait son maximum en certaines zones plus ou moins éloignées du noyau — typiquement, plusieurs dizaines de milliers de fois le rayon nucléaire.

    ·
    - Principe d'exclusion de Pauli
    Chaque électron est décrit, dans un atome, par un quadruplet de nombres quantiques (n, l, m, s) satisfaisant l'équation de Schrödinger
    et appelés respectivement :

    Le principe d'exclusion de Pauli stipule que deux fermions appartenant au même système de fermions (ici, au même atome) ne peuvent avoir tous leurs nombres quantiques égaux en même temps. Ce principe est fondamental car il est à l'origine de la configuration électronique des atomes : les électrons qui «s'empilent» dans l'atome doivent avoir chacun un état quantique distinct des autres, ce qui explique que toutes les orbitales atomiques sont progressivement occupées de la plus liée à la moins liée au noyau au fur et à mesure qu'on ajoute des électrons à l'atome ; c'est le principe d'Aufbau («édification» en allemand) matérialisé par la règle de Klechkowski (appelée aussi règle de Madelung), qui sous-tend l'agencement du tableau périodique des éléments chimiques en blocs et en périodes :

    [TABLE="class: MsoNormalTable"]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD] → 2 éléments sur la 1[SUP]re[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2p[/TD]
    [TD] 3 cases quantiques → 6 électrons[/TD]
    [TD] → 8 éléments sur la 2[SUP]e[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3p[/TD]
    [TD] 3 cases quantiques → 6 électrons[/TD]
    [TD] → 8 éléments sur la 3[SUP]e[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 4s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3d[/TD]
    [TD] 5 cases quantiques → 10 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 4p[/TD]
    [TD] 3 cases quantiques → 6 électrons[/TD]
    [TD] → 18 éléments sur la 4[SUP]e[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 5s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 4d[/TD]
    [TD] 5 cases quantiques → 10 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 5p[/TD]
    [TD] 3 cases quantiques → 6 électrons[/TD]
    [TD] → 18 éléments sur la 5[SUP]e[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 6s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 4f[/TD]
    [TD] 7 cases quantiques → 14 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 5d[/TD]
    [TD] 5 cases quantiques → 10 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 6p[/TD]
    [TD] 3 cases quantiques → 6 électrons[/TD]
    [TD] → 32 éléments sur la 6[SUP]e[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 7s[/TD]
    [TD] 1 case quantique → 2 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 5f[/TD]
    [TD] 7 cases quantiques → 14 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 6d[/TD]
    [TD] 5 cases quantiques → 10 électrons[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 7p[/TD]
    [TD] 3 cases quantiques → 6 électrons[/TD]
    [TD] → 32 éléments sur la 7[SUP]e[/SUP] période[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [/TABLE]

    - Orbitales moléculaire
    Sa structure électronique confère à l'atome ses propriétés chimiques et magnétiques. Ainsi, les éléments chimiques sont communément classés dans un tableau périodique organisé en fonction de leurs propriétés chimiques et dont l'agencement est en réalité déterminé par la distribution des électrons sur les niveaux d'énergie des atomes.
    Le recouvrement de deux orbitales atomiques appartenant chacune à un atome distinct peut conduire à la formation d'une orbitale moléculaire constituant une liaison chimique entre deux atomes ; si les orbitales atomiques en recouvrement appartiennent au même atome, on dit qu'il y a hybridation.
    Une orbitale moléculaire est dite liante lorsque les phases d'électron des orbitales atomiques sont de même signe (interférence constructive) ; elle est dite antiliante lorsque les orbitales atomiques ont des phases de signe opposé (interférence destructive).

    Noyau atomique
    Protons et neutrons forment un noyau atomique de dimension femtométrique. Le rayon nucléaire d'un atome dont le nombre de masse est A vaut environ [​IMG] fm, alors que l'atome lui-même a un rayon de l'ordre de la centaine de picomètres (environ 35 000 à 40 000 fois plus grand). Les protons étant chargés positivement, ils se repoussent au sein du noyau, mais l'intensité de cette répulsion électrostatique est très inférieure à celle de l'attraction entre nucléons induite par l'interaction nucléaire forte à des distances inférieures à 2,5 fm.

    La géométrie des noyaux atomiques est généralement sphérique, bien que certains noyaux stables suffisamment massifs adoptent également des formes sphéroïdes étirées en ballon de rugby ou, au contraire, aplaties. Certains noyaux instables, dits noyaux à halo, sont caractérisés par un ou plusieurs nucléons aux fonctions d'ondes très distendues, qui donnent au noyau des contours flous et un volume apparent très augmenté ; ces noyaux ont une cohésion nucléaire à la limite extrême du champ d'action de l'interaction forte.

    Dans le modèle de la goutte liquide, les protons tendent à se repousser les uns les autres et, par conséquent, à se concentrer vers l'extérieur des noyaux (aux «pôles» ou à l'«équateur» dans le cas de sphéroïdes), tandis que les neutrons tendent à s'accumuler au centre du noyau. Des dizaines de modèles ont été proposés afin d'expliquer les données expérimentales sur la nature et la structure des noyaux atomiques, mais aucun, à ce jour, ne suffit seul à rendre compte de l'ensemble des observations.

    Le volume nucléaire, estimé expérimentalement par des techniques de diffraction de faisceaux d'électrons, correspond à peu près à l'empilement de sphères dures représentant les nucléons, avec une densité nucléaire constante, ce qui se conceptualise très bien avec le modèle de la goutte liquide. Néanmoins, certaines propriétés quantiques de la structure nucléaire semblent mieux décrites par le modèle en couches, élaboré par les physiciens allemands Maria Goeppert-Mayer et Hans Daniel Jensen, qui ont obtenu le prix Nobel de physique en 1963 pour cette avancée. Leur modèle considère les nucléons comme des fermions soumis au principe d'exclusion de Pauli et répartis sur des niveaux d'énergie quantifiés — les «couches nucléaires» — de façon similaire aux électrons à l'échelle de l'atome. Dans le noyau, protons et neutrons constituent deux populations de fermions distinctes vis-à-vis du principe d'exclusion de Pauli.

    L'analogie avec les électrons a cependant ses limites, car, si les électrons interagissent entre eux et avec le noyau via l'interaction électromagnétique, les nucléons interagissent entre eux essentiellement via l'interaction nucléaire forte et l'interaction faible. Les niveaux d'énergie au sein du noyau ont ainsi une distribution différente de celle des niveaux d'énergie des électrons d'un atome. De plus, les phénomènes de couplage spin-orbite sont bien plus sensibles pour les nucléons que pour les électrons, ce qui redistribue les sous-couches nucléaires en fonction du spin (indiqué en indice dans le tableau ci-dessous):

    [TABLE="class: MsoNormalTable"]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1s[SUB] 1/2[/SUB] [/TD]
    [TD] 2 états [/TD]
    [TD] → 1[SUP]re[/SUP] couche : nombre magique = 2 [/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1p[SUB] 3/2[/SUB][/TD]
    [TD] 4 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1p[SUB] 1/2[/SUB][/TD]
    [TD] 2 états[/TD]
    [TD] → 2[SUP]e[/SUP] couche : nombre magique = 8[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1d[SUB] 5/2[/SUB][/TD]
    [TD] 6 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2s[SUB] 1/2[/SUB][/TD]
    [TD] 2 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1d[SUB] 3/2[/SUB][/TD]
    [TD] 4 états[/TD]
    [TD] → 3[SUP]e[/SUP] couche : nombre magique = 20[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1f[SUB] 7/2[/SUB][/TD]
    [TD] 8 états[/TD]
    [TD] → 4[SUP]e[/SUP] couche : nombre magique = 28[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2p[SUB] 3/2[/SUB][/TD]
    [TD] 4 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1f[SUB] 5/2[/SUB][/TD]
    [TD] 6 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2p[SUB] 1/2[/SUB][/TD]
    [TD] 2 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1g[SUB] 9/2[/SUB][/TD]
    [TD] 10 états[/TD]
    [TD] → 5[SUP]e[/SUP] couche : nombre magique = 50[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1g[SUB] 7/2[/SUB][/TD]
    [TD] 8 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2d[SUB] 5/2[/SUB][/TD]
    [TD] 6 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2d[SUB] 3/2[/SUB][/TD]
    [TD] 4 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3s[SUB] 1/2[/SUB][/TD]
    [TD] 2 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1h[SUB] 11/2[/SUB][/TD]
    [TD] 12 états[/TD]
    [TD] → 6[SUP]e[/SUP] couche : nombre magique = 82[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1h[SUB] 9/2[/SUB][/TD]
    [TD] 10 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2f[SUB] 7/2[/SUB][/TD]
    [TD] 8 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2f[SUB] 5/2[/SUB][/TD]
    [TD] 6 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3p[SUB] 3/2[/SUB][/TD]
    [TD] 4 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3p[SUB] 1/2[/SUB][/TD]
    [TD] 2 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1i[SUB] 13/2[/SUB][/TD]
    [TD] 14 états[/TD]
    [TD] → 7[SUP]e[/SUP] couche : nombre magique = 126[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2g[SUB] 9/2[/SUB][/TD]
    [TD] 10 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3d[SUB] 5/2[/SUB][/TD]
    [TD] 6 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1i[SUB] 11/2[/SUB][/TD]
    [TD] 12 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 2g[SUB] 7/2[/SUB][/TD]
    [TD] 8 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 4s[SUB] 1/2[/SUB][/TD]
    [TD] 2 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 3d[SUB] 3/2[/SUB][/TD]
    [TD] 4 états[/TD]
    [TD][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sous-couche 1j[SUB] 15/2[/SUB][/TD]
    [TD] 16 états[/TD]
    [TD] → 8[SUP]e[/SUP] couche : nombre magique = 184[/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 4"]
    [HR][/HR] ​
    [/TD]
    [/TR]
    [/TABLE]

    La saturation d'une couche nucléaire confère au noyau atomique une stabilité supérieure à celle calculée par la formule de Weizsäcker, issue du modèle de la goutte liquide — ce qui n'est pas sans rappeler l'inertie chimique des gaz rares, caractérisés par la saturation de leur sous-couche électronique p périphérique. Le nombre de nucléons d'une population donnée correspondant à la saturation d'une couche nucléaire est appelé «nombre magique» ; le noyau du plomb 208, qui est le plus lourd des isotopes stables, est ainsi constitué de 82 protons et 126 neutrons : 82 et 126 sont deux nombres magiques, ce qui explique la stabilité de ce nucléide par rapport à ceux qui n'en diffèrent que d'un ou deux nucléons.

    Classification


    Les atomes font le lien entre physique et chimie, de sorte que les notions relatives à ces deux domaines des sciences se recouvrent à leur sujet. Ainsi, en physique nucléaire, on appelle nucléide un noyau atomique défini par un nombre déterminé de protons et de neutrons, terme souvent confondu avec la notion équivalente d'isotope, qui relève davantage de la chimie.

    Un élément chimique se définit comme l'ensemble des atomes et des ions dont le noyau comporte un nombre donné de protons. Ce nombre est le numéro atomique, noté Z, de l'atome ou de l'élément chimique correspondant. Ainsi, tous les atomes n'ayant qu'un seul proton dans leur noyau (Z = 1) correspondent à l'élément chimique hydrogène. Il en existe trois variétés principales : le protium [SUP]1[/SUP]H, couramment appelé hydrogène (seul nucléide stable dépourvu de neutron), le deutérium [SUP]2[/SUP]H (stable, dont le noyau est constitué d'un proton et d'un neutron), le tritium [SUP]3[/SUP]H (radioactif, dont le noyau est constitué d'un proton et de deux neutrons). Ces nucléides sont des isotopes, car leur noyau compte le même nombre de protons mais un nombre différent de neutrons.
    La classification des atomes suit celle des éléments chimiques, dont les propriétés chimiques — mais aussi physiques — présentent une périodicité découverte au XIX[SUP]e[/SUP] siècle et à l'origine du tableau périodique des éléments. On emploie indifféremment les termes isotope stable et nucléide stable, radioisotope et radionucléide, ou encore élément superlourd et atome superlourd.

     
  5. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113
    Suite et fin : Atome______________________________________________


    Propriétés

    Noyaux atomiques
    - Moment magnétique nucléaire
    Les particules élémentaires possèdent un nombre quantique appelé spin analogue à un moment angulaire et mesuré en unités de constante de Planck réduite (parfois appelée «constante de Dirac») désignée par le symbole ħ, qui se lit «h barre». C'est également le cas des protons et des neutrons du noyau atomique, dont la résultante des spins se manifeste par un moment magnétique nucléaire. La valeur de ce dernier est spécifique à chaque noyau ; à l'état fondamental, elle est nulle pour les nucléides ayant à la fois un nombre pair de protons et un nombre pair de neutrons.

    Cette propriété est mise à profit en imagerie par résonance magnétique (IRM), fondée sur la résonance magnétique nucléaire (RMN) : un matériau soumis d'une part à un rayonnement électromagnétique, et d'autre part à un champ magnétique intense (de l'ordre du tesla) qui oriente les noyaux atomiques dans une direction privilégiée (mais en les séparant en deux populations correspondant aux deux sens de cette direction), absorbe une partie du rayonnement électromagnétique à une fréquence déterminée par le rapport gyromagnétique du noyau ciblé, ce qui permet de déterminer par spectroscopie la concentration spatiale de ce noyau — typiquement dans le domaine des radiofréquences pour les champs magnétiques ne dépassant pas 20 T.

    - Énergie de liaison nucléaire
    La liaison nucléaire est généralement décrite comme une manifestation résiduelle entre nucléons de l'interaction nucléaire forte qui maintient ensemble les quarks constituant les nucléons. L'énergie de liaison nucléaire est définie comme l'énergie nécessaire pour arracher un nucléon quelconque au noyau considéré. Elle est de l'ordre de quelques mégaélectron-volts par nucléon, partant de 0 (par définition) pour le protium [SUP]1[/SUP]H pour atteindre 7,57 MeV/A avec l'uranium 238 en passant par un maximum à 8,795 MeV/A pour le nickel 62. Cette propriété fondamentale explique pourquoi ce sont uniquement les atomes légers qui libèrent de l'énergie par fusion nucléaire tandis que ce sont uniquement les atomes lourds qui libèrent de l'énergie par fission nucléaire :

    • La fusion nucléaire survient lorsque des nucléons ou des noyaux atomiques s'assemblent pour former un noyau atomique plus gros. Si l'énergie de liaison nucléaire par nucléon est plus élevée dans le nouveau noyau, il y a libération d'énergie : c'est le cas dans les étoiles jusqu'au nickel 56, au niveau duquel s'arrête la nucléosynthèse stellaire ; le [SUP]56[/SUP]Ni étant instable, il se désintègre en fer 56, qui est stable. La nucléosynthèse ne se poursuit pas au-delà du nickel car le nucléide qui serait alors formé, le [SUP]60[/SUP]Zn, a une énergie de liaison nucléaire par nucléon inférieure à celle du [SUP]56[/SUP]Ni, et sa formation consommerait de l'énergie au lieu d'en libérer : c'est essentiellement à la toute fin de vie des étoiles, même de taille modeste, et particulièrement lors de l'explosion en supernovae des grosses étoiles, que les éléments plus lourds que le fer et le nickel sont formés.

    • La fission nucléaire n'est autre que l'éclatement d'un noyau atomique en au moins deux morceaux plus petits, avec libération de neutrons (car les noyaux légers sont proportionnellement moins riches en neutrons que les noyaux lourds). Si l'énergie de liaison nucléaire par nucléon est plus faible dans le noyau initial que dans les produits de fission alors il y a libération d'énergie : c'est le cas pour les noyaux plus massifs que ceux du nickel 62 ; l'uranium et le plutonium, par exemple, sont dans ce cas.
    -Stabilité nucléaire
    La physique des noyaux atomiques est gouvernée par les trois interactions fondamentales du modèle standard de la physique des particules : l'interaction forte, l'interaction faible et l'l'interaction électromagnétique. Chaque noyau atomique est défini par le nombre de protons et de neutrons qu'il contient, ainsi que par son énergie totale, l'ensemble définissant les différents «arrangements» des particules selon lesquels l'énergie totale du système peut être distribuée. Plus il y a d'arrangements possibles et plus le système est stable : l'état présentant le plus grand nombre d'arrangements possibles est appelé état fondamental ; c'est celui vers lequel tendent tous les autres états de ce système.

    Toute transition d'un état du système vers un autre requiert une énergie d'activation, fournie, dans le cas des noyaux atomiques, par les fluctuations du vide quantique. Lorsque de telles fluctuations suffisent à faire basculer un noyau atomique d'un état donné vers un état d'énergie inférieure, ce noyau est dit instable : on a affaire à un radionucléide. Jusqu'au calcium (Z = 20), les éléments chimiques ont des isotopes stables pour lesquels le nombre N de neutrons est à peu près égal au nombre Z de protons, tandis qu'au-delà de Z = 20 le ratio N/Z tend vers 3/2. Les isotopes instables, appelé radioisotopes, connaissent une désintégration radioactive qui leur permet de se rapprocher d'un état de plus grande stabilité.

    - Radioactivité
    La radioactivité désigne l'ensemble des phénomènes physiques par lesquels un nucléide instable réorganise sa structure nucléaire afin de gagner en stabilité. Ces phénomènes de désintégration radioactive peuvent être les suivants :




    • Fission spontanée : un gros noyau atomique « explose » en au moins deux fragments plus petits, avec émission de neutrons. Ce type de désintégration est observé notamment lorsque le ratio Z[SUP]2[/SUP]/A est au moins égal à 45 (c'est par exemple le cas du [SUP]252[/SUP]Cf).


    Chaque radioisotope est caractérisé par une période radioactive, qui correspond au temps nécessaire pour que la moitié des atomes de cet isotope se soit désintégrée. Un même nucléide peut connaître plusieurs modes de désintégration, la proportion relative de chacun de ces modes étant appelée rapport de branchement.

    - Îlot de stabilité
    Certaines théories extrapolent les résultats du modèle en couches et les propriétés des nombres magiques en prédisant l'existence d'un îlot de stabilité parmi les nucléides superlourds, pour un nombre magique de 184 neutrons et — selon les théories et les modèles — 114, 120, 122 ou 126 protons. Une approche plus moderne de la stabilité nucléaire montre toutefois, par des calculs fondés sur l'effet tunnel, que, si de tels noyaux superlourds doublement magiques seraient probablement stables du point de vue de la fission spontanée, ils devraient cependant connaître des désintégrations α avec une période radioactive de quelques microsecondes. Un îlot de relative stabilité pourrait néanmoins exister autour du darmstadtium 293, correspondant aux nucléides définis par Z compris entre 104 et 116, et N compris entre 176 et 186 : ces éléments pourraient avoir des isotopes présentant des périodes radioactives atteignant quelques minutes.

    - Limite à la taille des noyaux
    Le plus lourd des nucléides synthétisés jusqu'à présent est l'isotope [SUP]294[/SUP]118 et les recherches se poursuivent au GSI afin de produire l'isotope [SUP]302[/SUP]120. On ignore précisément jusqu'à combien de nucléons un noyau atomique peut contenir : on estime habituellement la limite d'observabilité expérimentale à environ Z ≈ 130 et la limite théorique à Z = 173 : un 174[SUP]ème[/SUP] proton (ou neutron) conférerait à la couche nucléaire 1s[SUB]1/2[/SUB] une énergie de – 511 keV, égale à la masse au repos d'un électron ou d'un positron ; un tel noyau serait donc instable par rapport à la désintégration β.

    Nuage électronique
    Si les propriétés nucléaires de l'atome (masse, énergie nucléaire, radioactivité...) relèvent de la physique, et particulièrement de la physique nucléaire et de la physique des particules, les propriétés des nuages électroniques des atomes (taille, énergie d'ionisation, conductivité électrique, valence...) relèvent essentiellement de la chimie et de la science des matériaux.

    -Taille des atomes
    Le nuage électronique d'un atome n'a pas de dimensions bien définies car il consiste en une superposition d'orbitales atomiques de nature probabiliste. Il n'existe donc pas de définition unique ni de mesure définitive de la taille des atomes : celle-ci est généralement définie en termes de distance moyenne entre noyaux d'atomes liés entre eux, mais cette distance varie en fonction de la nature chimique des atomes environnants, du nombre et de la géométrie des liaisons dans lesquelles l'atome est engagé, ou encore de la nature de ces liaisons (métallique, covalente, ionique...). Une valeur théorique de l'extension des orbitales atomiques peut néanmoins être calculée pour chaque noyau atomique, ce qui donne une valeur en excès par rapport aux méthodes empiriques fondées sur la géométrie des mailles cristallines, ou aux mesures effectuées sur des molécules :

    [TABLE="class: MsoNormalTable"]
    [TR]
    [TD]
    H
    53​
    [/TD]
    [TD="colspan: 17"][/TD]
    [TD="width: 34"]
    He
    31​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Li
    167​
    [/TD]
    [TD="width: 33"]
    Be
    112​
    [/TD]
    [TD="colspan: 11"][/TD]
    [TD="width: 33"]
    B
    87​
    [/TD]
    [TD="width: 33"]
    C
    67​
    [/TD]
    [TD="width: 34"]
    N
    56​
    [/TD]
    [TD="width: 33"]
    O
    48​
    [/TD]
    [TD="width: 33"]
    F
    42​
    [/TD]
    [TD="width: 34"]
    Ne
    38​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Na
    190​
    [/TD]
    [TD="width: 33"]
    Mg
    145​
    [/TD]
    [TD="colspan: 11"][/TD]
    [TD="width: 33"]
    Al
    118​
    [/TD]
    [TD="width: 33"]
    Si
    111​
    [/TD]
    [TD="width: 34"]
    P
    98​
    [/TD]
    [TD="width: 33"]
    S
    88​
    [/TD]
    [TD="width: 33"]
    Cl
    79​
    [/TD]
    [TD="width: 34"]
    Ar
    71​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    K
    243​
    [/TD]
    [TD="width: 33"]
    Ca
    194​
    [/TD]
    [TD][/TD]
    [TD="width: 33"]
    Sc
    184​
    [/TD]
    [TD="width: 33"]
    Ti
    176​
    [/TD]
    [TD="width: 33"]
    V
    171​
    [/TD]
    [TD="width: 33"]
    Cr
    166​
    [/TD]
    [TD="width: 33"]
    Mn
    161​
    [/TD]
    [TD="width: 33"]
    Fe
    156​
    [/TD]
    [TD="width: 33"]
    Co
    152​
    [/TD]
    [TD="width: 33"]
    Ni
    149​
    [/TD]
    [TD="width: 33"]
    Cu
    145​
    [/TD]
    [TD="width: 33"]
    Zn
    142​
    [/TD]
    [TD="width: 33"]
    Ga
    136​
    [/TD]
    [TD="width: 33"]
    Ge
    125​
    [/TD]
    [TD="width: 34"]
    As
    114​
    [/TD]
    [TD="width: 33"]
    Se
    103​
    [/TD]
    [TD="width: 33"]
    Br
    94​
    [/TD]
    [TD="width: 34"]
    Kr
    88​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Rb
    265​
    [/TD]
    [TD="width: 33"]
    Sr
    219​
    [/TD]
    [TD][/TD]
    [TD="width: 33"]
    Y
    212​
    [/TD]
    [TD="width: 33"]
    Zr
    206​
    [/TD]
    [TD="width: 33"]
    Nb
    198​
    [/TD]
    [TD="width: 33"]
    Mo
    190​
    [/TD]
    [TD="width: 33"]
    Tc
    183​
    [/TD]
    [TD="width: 33"]
    Ru
    178​
    [/TD]
    [TD="width: 33"]
    Rh
    173​
    [/TD]
    [TD="width: 33"]
    Pd
    169​
    [/TD]
    [TD="width: 33"]
    Ag
    165​
    [/TD]
    [TD="width: 33"]
    Cd
    161​
    [/TD]
    [TD="width: 33"]
    In
    156​
    [/TD]
    [TD="width: 33"]
    Sn
    145​
    [/TD]
    [TD="width: 34"]
    Sb
    133​
    [/TD]
    [TD="width: 33"]
    Te
    123​
    [/TD]
    [TD="width: 33"]
    I
    115​
    [/TD]
    [TD="width: 34"]
    Xe
    108​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Cs
    298​
    [/TD]
    [TD="width: 33"]
    Ba
    253​
    [/TD]
    [TD]
    * ​
    [/TD]
    [TD="width: 33"]
    Lu
    217​
    [/TD]
    [TD="width: 33"]
    Hf
    208​
    [/TD]
    [TD="width: 33"]
    Ta
    200​
    [/TD]
    [TD="width: 33"]
    W
    193​
    [/TD]
    [TD="width: 33"]
    Re
    188​
    [/TD]
    [TD="width: 33"]
    Os
    185​
    [/TD]
    [TD="width: 33"]
    Ir
    180​
    [/TD]
    [TD="width: 33"]
    Pt
    177​
    [/TD]
    [TD="width: 33"]
    Au
    174​
    [/TD]
    [TD="width: 33"]
    Hg
    171​
    [/TD]
    [TD="width: 33"]
    Tl
    156​
    [/TD]
    [TD="width: 33"]
    Pb
    154​
    [/TD]
    [TD="width: 34"]
    Bi
    143​
    [/TD]
    [TD="width: 33"]
    Po
    135​
    [/TD]
    [TD="width: 33"]
    At
    n.d.​
    [/TD]
    [TD="width: 34"]
    Rn
    120​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Fr
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ra
    n.d.​
    [/TD]
    [TD]
    * ​
    [/TD]
    [TD="width: 33"]
    Lw
    n.d.​
    [/TD]
    [TD="width: 33"]
    Rf
    n.d.​
    [/TD]
    [TD="width: 33"]
    Db
    n.d.​
    [/TD]
    [TD="width: 33"]
    Sg
    n.d.​
    [/TD]
    [TD="width: 33"]
    Bh
    n.d.​
    [/TD]
    [TD="width: 33"]
    Hs
    n.d.​
    [/TD]
    [TD="width: 33"]
    Mt
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ds
    n.d.​
    [/TD]
    [TD="width: 33"]
    Rg
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cn
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uut
    n.d.​
    [/TD]
    [TD="width: 33"]
    Fl
    n.d.​
    [/TD]
    [TD="width: 34"]
    Uup
    n.d.​
    [/TD]
    [TD="width: 33"]
    Lv
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uus
    n.d.​
    [/TD]
    [TD="width: 34"]
    Uuo
    n.d.​
    [/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    ↓​
    [/TD]
    [TD="colspan: 16"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    *​
    [/TD]
    [TD="width: 33"]
    La
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ce
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pr
    n.d.​
    [/TD]
    [TD="width: 33"]
    Nd
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Sm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Eu
    n.d.​
    [/TD]
    [TD="width: 33"]
    Gd
    n.d.​
    [/TD]
    [TD="width: 33"]
    Tb
    n.d.​
    [/TD]
    [TD="width: 33"]
    Dy
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ho
    n.d.​
    [/TD]
    [TD="width: 33"]
    Er
    n.d.​
    [/TD]
    [TD="width: 34"]
    Tm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Yb
    n.d.​
    [/TD]
    [TD="colspan: 2"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    *​
    [/TD]
    [TD="width: 33"]
    Ac
    n.d.​
    [/TD]
    [TD="width: 33"]
    Th
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pa
    n.d.​
    [/TD]
    [TD="width: 33"]
    U
    n.d.​
    [/TD]
    [TD="width: 33"]
    Np
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pu
    n.d.​
    [/TD]
    [TD="width: 33"]
    Am
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Bk
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cf
    n.d.​
    [/TD]
    [TD="width: 33"]
    Es
    n.d.​
    [/TD]
    [TD="width: 33"]
    Fm
    n.d.​
    [/TD]
    [TD="width: 34"]
    Md
    n.d.​
    [/TD]
    [TD="width: 33"]
    Nb
    n.d.​
    [/TD]
    [TD="colspan: 2"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 19"][/TD]
    [/TR]
    [/TABLE]
    Tableau périodique des éléments indiquant leur rayon atomique théorique en picomètres

    Au-delà des valeurs numériques, qui ne doivent être vues ici que comme indicatives, ce tableau permet d'illustrer deux tendances :


    • En parcourant une période (ligne du tableau) de gauche à droite, la taille des atomes diminue en raison de l'attraction croissante du noyau atomique, de plus en plus chargé positivement, qui limite l'extension spatiale des orbitales atomiques, chargées négativement, en les rapprochant du noyau.
    La contraction des lanthanides illustre bien ce dernier phénomène, et est à l'origine du fait que les atomes des métaux de transition des cinquième et sixième périodes ont des tailles à peu près égales : à peine deux picomètres de plus pour le hafnium et le tantale que pour le zirconium et le niobium ; il s'ensuit une augmentation sensible de la masse volumique des métaux correspondants, par exemple 6,5 et 13,3 g/cm[SUP]3[/SUP] respectivement pour le zirconium et le hafnium — soit plus qu'un doublement.

    - Liaisons chimiques
    L'une des propriétés les plus remarquables des atomes est leur propension à former toute une variété de liaisons chimiques avec d'autres atomes, afin de constituer des édifices moléculaires, des cristaux, voire des agrégats atomiques (clusters, «superatomes»). Ces liaisons résultent du recouvrement d'orbitales atomiques appartenant à deux atomes pour former une orbitale moléculaire occupée par deux électrons provenant chacun d'un des deux atomes engagés dans la liaison (on parle dans ce cas de liaison covalente), mais peuvent aussi provenir de l'attraction électrostatique entre atomes de charge électrique opposée (un cation positif et un anion négatif : on parle alors de liaison ionique).

    La réactivité chimique des atomes dépend du nombre d'électrons qu'ils possèdent dans leurs sous-couches électroniques périphériques (sous-couches s et p) — les électrons de valence. En vertu de la règle de l'octet, chaque atome tend en effet à atteindre un état où ses sous-couches s et p périphériques sont saturées d'électrons : deux électrons dans la sous-couche s et six électrons dans la sous-couche p. Par exemple, l'hydrogène n'a qu'un unique électron dans sa sous-couche 1s, de sorte qu'il s'associe avec un autre atome pour acquérir le second électron qu'il manque à cette sous-couche pour être saturée : on dit que l'hydrogène est monovalent. L'oxygène, lui, a quatre électrons dans sa sous-couche 2p, et s'associe donc avec deux autres atomes pour acquérir les deux électrons qui manquent à cette sous-couche pour être saturée : l'oxygène est donc divalent. Le carbone, ayant deux électrons dans sa sous-couche 2p, est tétravalent. Les gaz rares les plus légers tels que l'hélium et le néon, avec respectivement deux électrons dans la sous-couche 1s et six électrons dans la sous-couche 2p, sont à peu près inertes chimiquement car leur configuration électronique est déjà saturée d'électrons de valence — mais il existe une chimie des gaz rares concernant les gaz rares plus lourds, qui présentent une réactivité chimique non nulle en raison de l'écrantage du noyau par les électrons de cœur qui rend les électrons périphériques plus mobilisables.

    La liaison covalente est une liaison forte : celle qui unit les deux atomes d'iode de la molécule I[SUB]2[/SUB] n'est que de 151 kJ/mol, mais atteint 436 kJ/mol pour la molécule H[SUB]2[/SUB], 498 kJ/mol pour O[SUB]2[/SUB], et 945 kJ/mol pour N[SUB]2[/SUB].

    Un autre type de liaison chimique s'observe dans les métaux : la liaison métallique. Les atomes métalliques ont en effet la propriété, lorsqu'ils s'assemblent, de faire apparaître, par recouvrement de leurs orbitales atomiques périphériques, une «bande de conduction» qui peut être occupée par des électrons délocalisés (on parle «d'aromaticité métallique») issus des orbitales les moins liées de ces atomes ; la conductivité électrique des métaux résulte du fait qu'il existe un nombre bien plus élevé de configurations électroniques possibles (on parle de densité d'états électroniques) qu'il y a d'électrons dans cette bande de conduction, de sorte que ces derniers y constituent un «gaz d'électrons».

    Des atomes appartenant à des molécules distinctes peuvent également interagir avec leur nuage électronique autrement que par liaison covalente ou ionique. Ainsi, un atome d'halogène déficitaire en électrons et facilement polarisable peut former une liaison halogène avec les atomes ou groupements fonctionnels riches en électrons, tels que des dérivés oxygénés ou azotés. De même, une molécule ayant un atome d'hydrogène acide peut former une liaison faible (de 5 à 20 kJ/mol) avec un atome électronégatif ayant des doublets non liants. Enfin, l'interaction des moments dipôlaires de deux atomes est à l'origine de la force de van der Waals, dont la force est du même ordre de grandeur que celle de la liaison hydrogène.

    - Électronégativité et affinité électronique
    Compte tenu de leur configuration électronique, certains atomes auront davantage tendance que d'autres à attirer des électrons en formant des liaisons chimiques covalentes. Cette propriété est appelée l'électronégativité d'un atome. Elle dépend en premier lieu de leur nombre de masse et, corrélativement, de l'intensité de la liaison entre le noyau atomique et des électrons de valence. Elle est généralement évaluée à l'aide de l'échelle de Pauling, du nom de Linus Pauling qui la mit au point en 1932. D'autres méthodes d'évaluation donnent des résultats légèrement différents, mais toutes révèlent les mêmes tendances à travers le tableau périodique.

    [TABLE="class: MsoNormalTable"]
    [TR]
    [TD]
    H
    2,20​
    [/TD]
    [TD="colspan: 17"][/TD]
    [TD="width: 32"]
    He
    n.d.​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Li
    0,98​
    [/TD]
    [TD="width: 33"]
    Be
    1,57​
    [/TD]
    [TD="colspan: 11"][/TD]
    [TD="width: 33"]
    B
    2,04​
    [/TD]
    [TD="width: 33"]
    C
    2,55​
    [/TD]
    [TD="width: 33"]
    N
    3,04​
    [/TD]
    [TD="width: 33"]
    O
    3,44​
    [/TD]
    [TD="width: 33"]
    F
    3,98​
    [/TD]
    [TD="width: 32"]
    Ne
    n.d.​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Na
    0,93​
    [/TD]
    [TD="width: 33"]
    Mg
    1,31​
    [/TD]
    [TD="colspan: 11"][/TD]
    [TD="width: 33"]
    Al
    1,61​
    [/TD]
    [TD="width: 33"]
    Si
    1,90​
    [/TD]
    [TD="width: 33"]
    P
    2,19​
    [/TD]
    [TD="width: 33"]
    S
    2,58​
    [/TD]
    [TD="width: 33"]
    Cl
    3,16​
    [/TD]
    [TD="width: 32"]
    Ar
    n.d.​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    K
    0,82​
    [/TD]
    [TD="width: 33"]
    Ca
    1,00​
    [/TD]
    [TD][/TD]
    [TD="width: 33"]
    Sc
    1,36​
    [/TD]
    [TD="width: 33"]
    Ti
    1,54​
    [/TD]
    [TD="width: 33"]
    V
    1,63​
    [/TD]
    [TD="width: 33"]
    Cr
    1,66​
    [/TD]
    [TD="width: 33"]
    Mn
    1,55​
    [/TD]
    [TD="width: 33"]
    Fe
    1,83​
    [/TD]
    [TD="width: 33"]
    Co
    1,88​
    [/TD]
    [TD="width: 33"]
    Ni
    1,91​
    [/TD]
    [TD="width: 33"]
    Cu
    1,90​
    [/TD]
    [TD="width: 33"]
    Zn
    1,65​
    [/TD]
    [TD="width: 33"]
    Ga
    1,81​
    [/TD]
    [TD="width: 33"]
    Ge
    2,01​
    [/TD]
    [TD="width: 33"]
    As
    2,18​
    [/TD]
    [TD="width: 33"]
    Se
    2,55​
    [/TD]
    [TD="width: 33"]
    Br
    2,96​
    [/TD]
    [TD="width: 32"]
    Kr
    3,0​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Rb
    0,82​
    [/TD]
    [TD="width: 33"]
    Sr
    0,95​
    [/TD]
    [TD][/TD]
    [TD="width: 33"]
    Y
    1,22​
    [/TD]
    [TD="width: 33"]
    Zr
    1,33​
    [/TD]
    [TD="width: 33"]
    Nb
    1,6​
    [/TD]
    [TD="width: 33"]
    Mo
    2,16​
    [/TD]
    [TD="width: 33"]
    Tc
    1,9​
    [/TD]
    [TD="width: 33"]
    Ru
    2,2​
    [/TD]
    [TD="width: 33"]
    Rh
    2,28​
    [/TD]
    [TD="width: 33"]
    Pd
    2,20​
    [/TD]
    [TD="width: 33"]
    Ag
    1,93​
    [/TD]
    [TD="width: 33"]
    Cd
    1,69​
    [/TD]
    [TD="width: 33"]
    In
    1,78​
    [/TD]
    [TD="width: 33"]
    Sn
    1,96​
    [/TD]
    [TD="width: 33"]
    Sb
    2,05​
    [/TD]
    [TD="width: 33"]
    Te
    2,1​
    [/TD]
    [TD="width: 33"]
    I
    2,66​
    [/TD]
    [TD="width: 32"]
    Xe
    2,6​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Cs
    0,79​
    [/TD]
    [TD="width: 33"]
    Ba
    0,89​
    [/TD]
    [TD]
    * ​
    [/TD]
    [TD="width: 33"]
    Lu
    1,27​
    [/TD]
    [TD="width: 33"]
    Hf
    1,3​
    [/TD]
    [TD="width: 33"]
    Ta
    1,5​
    [/TD]
    [TD="width: 33"]
    W
    2,36​
    [/TD]
    [TD="width: 33"]
    Re
    1,9​
    [/TD]
    [TD="width: 33"]
    Os
    2,2​
    [/TD]
    [TD="width: 33"]
    Ir
    2,20​
    [/TD]
    [TD="width: 33"]
    Pt
    2,28​
    [/TD]
    [TD="width: 33"]
    Au
    2,54​
    [/TD]
    [TD="width: 33"]
    Hg
    2,0​
    [/TD]
    [TD="width: 33"]
    Tl
    1,62​
    [/TD]
    [TD="width: 33"]
    Pb
    2,33​
    [/TD]
    [TD="width: 33"]
    Bi
    2,02​
    [/TD]
    [TD="width: 33"]
    Po
    2,0​
    [/TD]
    [TD="width: 33"]
    At
    2,2​
    [/TD]
    [TD="width: 32"]
    Rn
    2,2​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Fr
    0,7​
    [/TD]
    [TD="width: 33"]
    Ra
    0,9​
    [/TD]
    [TD]
    * ​
    [/TD]
    [TD="width: 33"]
    Lw
    1,3​
    [/TD]
    [TD="width: 33"]
    Rf
    n.d.​
    [/TD]
    [TD="width: 33"]
    Db
    n.d.​
    [/TD]
    [TD="width: 33"]
    Sg
    n.d.​
    [/TD]
    [TD="width: 33"]
    Bh
    n.d.​
    [/TD]
    [TD="width: 33"]
    Hs
    n.d.​
    [/TD]
    [TD="width: 33"]
    Mt
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ds
    n.d.​
    [/TD]
    [TD="width: 33"]
    Rg
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cn
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uut
    n.d.​
    [/TD]
    [TD="width: 33"]
    Fl
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uup
    n.d.​
    [/TD]
    [TD="width: 33"]
    Lv
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uus
    n.d.​
    [/TD]
    [TD="width: 32"]
    Uuo
    n.d.​
    [/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    ↓​
    [/TD]
    [TD="colspan: 16"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    *​
    [/TD]
    [TD="width: 33"]
    La
    1,1​
    [/TD]
    [TD="width: 33"]
    Ce
    1,12​
    [/TD]
    [TD="width: 33"]
    Pr
    1,13​
    [/TD]
    [TD="width: 33"]
    Nd
    1,14​
    [/TD]
    [TD="width: 33"]
    Pm
    1,13​
    [/TD]
    [TD="width: 33"]
    Sm
    1,17​
    [/TD]
    [TD="width: 33"]
    Eu
    1,2​
    [/TD]
    [TD="width: 33"]
    Gd
    1,2​
    [/TD]
    [TD="width: 33"]
    Tb
    1,1​
    [/TD]
    [TD="width: 33"]
    Dy
    1,22​
    [/TD]
    [TD="width: 33"]
    Ho
    1,23​
    [/TD]
    [TD="width: 33"]
    Er
    1,24​
    [/TD]
    [TD="width: 33"]
    Tm
    1,25​
    [/TD]
    [TD="width: 33"]
    Yb
    1,1​
    [/TD]
    [TD="colspan: 2"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    *​
    [/TD]
    [TD="width: 33"]
    Ac
    1,1​
    [/TD]
    [TD="width: 33"]
    Th
    1,3​
    [/TD]
    [TD="width: 33"]
    Pa
    1,5​
    [/TD]
    [TD="width: 33"]
    U
    1,38​
    [/TD]
    [TD="width: 33"]
    Np
    1,26​
    [/TD]
    [TD="width: 33"]
    Pu
    1,28​
    [/TD]
    [TD="width: 33"]
    Am
    1,13​
    [/TD]
    [TD="width: 33"]
    Cm
    1,28​
    [/TD]
    [TD="width: 33"]
    Bk
    1,3​
    [/TD]
    [TD="width: 33"]
    Cf
    1,3​
    [/TD]
    [TD="width: 33"]
    Es
    1,3​
    [/TD]
    [TD="width: 33"]
    Fm
    1,3​
    [/TD]
    [TD="width: 33"]
    Md
    1,3​
    [/TD]
    [TD="width: 33"]
    Nb
    1,3​
    [/TD]
    [TD="colspan: 2"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 19"][/TD]
    [/TR]
    [/TABLE]

    La lecture de ce tableau permet de dégager deux tendances principales :

    • Lorsqu'on parcourt de haut en bas une colonne du tableau, l'électronégativité diminue car les électrons de valence sont séparés du noyau par un nombre croissant de sous-couches électroniques et sont donc de moins en moins liés à lui, d'où une affinité d'intensité décroissante.

    • Lorsqu'on parcourt de gauche à droite une période du tableau, l'électronégativité est minimale à gauche et maximale à droite ; cela provient du fait que les alcalins ont plutôt tendance à perdre un électron qu'à en gagner pour acquérir la configuration électronique d'un gaz rare, tandis que les halogènes ont fortement tendance à gagner un électron pour saturer leur sous-couche p et acquérir la configuration électronique d'un gaz rare.
    Le cas des gaz rares eux-mêmes est particulier car les plus légers d'entre eux sont chimiquement inertes, une véritable chimie des gaz rares n'existant que pour le krypton et, surtout, le xénon — le radon est trop radioactif pour présenter une chimie significative.
    L'électronégativité n'est pas une notion atomique absolue, mais plutôt une propriété chimique relative aux atomes engagés dans une liaison avec d'autres atomes. La propriété atomique stricto sensu correspondant à l'électronégativité est appelée affinité électronique et correspond à l'énergie libérée par l'adjonction d'un électron à un atome neutre pour former un anion. Il s'agit donc d'une grandeur physique mesurable, contrairement à l'électronégativité.

    [TABLE="class: MsoNormalTable"]
    [TR]
    [TD]
    H
    73​
    [/TD]
    [TD="colspan: 17"][/TD]
    [TD="width: 34"]
    He
    *​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Li
    60​
    [/TD]
    [TD="width: 33"]
    Be
    *​
    [/TD]
    [TD="colspan: 11"][/TD]
    [TD="width: 33"]
    B
    27​
    [/TD]
    [TD="width: 33"]
    C
    122​
    [/TD]
    [TD="width: 34"]
    N
    *​
    [/TD]
    [TD="width: 33"]
    O
    141​
    [/TD]
    [TD="width: 33"]
    F
    328​
    [/TD]
    [TD="width: 34"]
    Ne
    *​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Na
    53​
    [/TD]
    [TD="width: 33"]
    Mg
    *​
    [/TD]
    [TD="colspan: 11"][/TD]
    [TD="width: 33"]
    Al
    42​
    [/TD]
    [TD="width: 33"]
    Si
    134​
    [/TD]
    [TD="width: 34"]
    P
    72​
    [/TD]
    [TD="width: 33"]
    S
    200​
    [/TD]
    [TD="width: 33"]
    Cl
    349​
    [/TD]
    [TD="width: 34"]
    Ar
    *​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    K
    48​
    [/TD]
    [TD="width: 33"]
    Ca
    2​
    [/TD]
    [TD][/TD]
    [TD="width: 33"]
    Sc
    18​
    [/TD]
    [TD="width: 33"]
    Ti
    8​
    [/TD]
    [TD="width: 33"]
    V
    51​
    [/TD]
    [TD="width: 33"]
    Cr
    65​
    [/TD]
    [TD="width: 33"]
    Mn
    *​
    [/TD]
    [TD="width: 33"]
    Fe
    15​
    [/TD]
    [TD="width: 33"]
    Co
    64​
    [/TD]
    [TD="width: 33"]
    Ni
    112​
    [/TD]
    [TD="width: 33"]
    Cu
    119​
    [/TD]
    [TD="width: 33"]
    Zn
    *​
    [/TD]
    [TD="width: 33"]
    Ga
    41​
    [/TD]
    [TD="width: 33"]
    Ge
    119​
    [/TD]
    [TD="width: 34"]
    As
    79​
    [/TD]
    [TD="width: 33"]
    Se
    195​
    [/TD]
    [TD="width: 33"]
    Br
    324​
    [/TD]
    [TD="width: 34"]
    Kr
    *​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Rb
    47​
    [/TD]
    [TD="width: 33"]
    Sr
    5​
    [/TD]
    [TD][/TD]
    [TD="width: 33"]
    Y
    30​
    [/TD]
    [TD="width: 33"]
    Zr
    41​
    [/TD]
    [TD="width: 33"]
    Nb
    86​
    [/TD]
    [TD="width: 33"]
    Mo
    72​
    [/TD]
    [TD="width: 33"]
    Tc
    *​
    [/TD]
    [TD="width: 33"]
    Ru
    101​
    [/TD]
    [TD="width: 33"]
    Rh
    110​
    [/TD]
    [TD="width: 33"]
    Pd
    56​
    [/TD]
    [TD="width: 33"]
    Ag
    126​
    [/TD]
    [TD="width: 33"]
    Cd
    *​
    [/TD]
    [TD="width: 33"]
    In
    39​
    [/TD]
    [TD="width: 33"]
    Sn
    107​
    [/TD]
    [TD="width: 34"]
    Sb
    101​
    [/TD]
    [TD="width: 33"]
    Te
    190​
    [/TD]
    [TD="width: 33"]
    I
    295​
    [/TD]
    [TD="width: 34"]
    Xe
    *​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Cs
    46​
    [/TD]
    [TD="width: 33"]
    Ba
    14​
    [/TD]
    [TD]
    * ​
    [/TD]
    [TD="width: 33"]
    Lu
    33​
    [/TD]
    [TD="width: 33"]
    Hf
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ta
    31​
    [/TD]
    [TD="width: 33"]
    W
    79​
    [/TD]
    [TD="width: 33"]
    Re
    *​
    [/TD]
    [TD="width: 33"]
    Os
    104​
    [/TD]
    [TD="width: 33"]
    Ir
    150​
    [/TD]
    [TD="width: 33"]
    Pt
    205​
    [/TD]
    [TD="width: 33"]
    Au
    223​
    [/TD]
    [TD="width: 33"]
    Hg
    *​
    [/TD]
    [TD="width: 33"]
    Tl
    36​
    [/TD]
    [TD="width: 33"]
    Pb
    35​
    [/TD]
    [TD="width: 34"]
    Bi
    91​
    [/TD]
    [TD="width: 33"]
    Po
    n.d.​
    [/TD]
    [TD="width: 33"]
    At
    n.d.​
    [/TD]
    [TD="width: 34"]
    Rn
    *​
    [/TD]
    [/TR]
    [TR]
    [TD="width: 33"]
    Fr
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ra
    n.d.​
    [/TD]
    [TD]
    * ​
    [/TD]
    [TD="width: 33"]
    Lw
    n.d.​
    [/TD]
    [TD="width: 33"]
    Rf
    n.d.​
    [/TD]
    [TD="width: 33"]
    Db
    n.d.​
    [/TD]
    [TD="width: 33"]
    Sg
    n.d.​
    [/TD]
    [TD="width: 33"]
    Bh
    n.d.​
    [/TD]
    [TD="width: 33"]
    Hs
    n.d.​
    [/TD]
    [TD="width: 33"]
    Mt
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ds
    n.d.​
    [/TD]
    [TD="width: 33"]
    Rg
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cn
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uut
    n.d.​
    [/TD]
    [TD="width: 33"]
    Fl
    n.d.​
    [/TD]
    [TD="width: 34"]
    Uup
    n.d.​
    [/TD]
    [TD="width: 33"]
    Lv
    n.d.​
    [/TD]
    [TD="width: 33"]
    Uus
    n.d.​
    [/TD]
    [TD="width: 34"]
    Uuo
    n.d.​
    [/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    ↓​
    [/TD]
    [TD="colspan: 16"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    *
    [/TD]
    [TD="width: 33"]
    La
    45​
    [/TD]
    [TD="width: 33"]
    Ce
    92​
    [/TD]
    [TD="width: 33"]
    Pr
    n.d.​
    [/TD]
    [TD="width: 33"]
    Nd
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Sm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Eu
    n.d.​
    [/TD]
    [TD="width: 33"]
    Gd
    n.d.​
    [/TD]
    [TD="width: 33"]
    Tb
    n.d.​
    [/TD]
    [TD="width: 33"]
    Dy
    n.d.​
    [/TD]
    [TD="width: 33"]
    Ho
    n.d.​
    [/TD]
    [TD="width: 33"]
    Er
    n.d.​
    [/TD]
    [TD="width: 34"]
    Tm
    99​
    [/TD]
    [TD="width: 33"]
    Yb
    n.d.​
    [/TD]
    [TD="colspan: 2"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 2"][/TD]
    [TD]
    *​
    [/TD]
    [TD="width: 33"]
    Ac
    n.d.​
    [/TD]
    [TD="width: 33"]
    Th
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pa
    n.d.​
    [/TD]
    [TD="width: 33"]
    U
    n.d.​
    [/TD]
    [TD="width: 33"]
    Np
    n.d.​
    [/TD]
    [TD="width: 33"]
    Pu
    n.d.​
    [/TD]
    [TD="width: 33"]
    Am
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cm
    n.d.​
    [/TD]
    [TD="width: 33"]
    Bk
    n.d.​
    [/TD]
    [TD="width: 33"]
    Cf
    n.d.​
    [/TD]
    [TD="width: 33"]
    Es
    n.d.​
    [/TD]
    [TD="width: 33"]
    Fm
    n.d.​
    [/TD]
    [TD="width: 34"]
    Md
    n.d.​
    [/TD]
    [TD="width: 33"]
    Nb
    n.d.​
    [/TD]
    [TD="colspan: 2"][/TD]
    [/TR]
    [TR]
    [TD="colspan: 19"][/TD]
    [/TR]
    [/TABLE]

    Les valeurs représentées par un astérisque dans le tableau ci-dessus sont voisines de zéro d'après l'interprétation quantique de la configuration électronique des atomes correspondants. On note que l'affinité électronique ne présente pas la périodicité régulière de l'électronégativité, mais qu'elle est tout de même la plus élevée pour les halogènes et sensiblement plus faible pour les métaux alcalins et, surtout, alcalino-terreux.

    - Magnétisme
    Comme les nucléons, les électrons possèdent un spin, analogue à un moment angulaire, intrinsèque à chaque électron, auquel se superpose un moment angulaire orbital, représenté par le nombre quantique secondaire, généré par la distribution probabiliste de l'électron dans son orbitale atomique, qui s'assimile à un «mouvement». Ces deux moments angulaires se combinent pour constituer un champ magnétique autour de l'atome. Lorsque deux électrons occupent une case quantique de l'atome, ils ont chacun un spin opposé en vertu du principe d'exclusion de Pauli, ce qui annule le moment angulaire résultant ; mais les atomes et les ions qui ont un nombre impair d'électrons ont par conséquent un moment magnétique résultant non nul provenant du spin de leurs électrons.

    Les matériaux ferromagnétiques ont la particularité d'orienter dans la même direction les moments magnétiques de leurs atomes par interaction d'échange, ce qui crée un champ magnétique macroscopique : c'est le cas, par exemple, de la magnétite Fe[SUB]3[/SUB]O[SUB]4[/SUB]. Certains matériaux orientent au contraire les moments magnétiques de leurs atomes dans des directions alternativement opposées, ce qu'on appelle «antiferromagnétisme».
    Les matériaux paramagnétiques révèlent leur magnétisme intrinsèque uniquement sous l'effet d'un champ magnétique extérieur, qui aligne le moment magnétique de leurs atomes tant qu'il est présent (susceptibilité magnétique positive) ; dès que ce champ magnétique extérieur cesse d'être appliqué, la magnétisation d'un matériau paramagnétique disparaît.

    Les atomes ayant des électrons non appariés dans leurs sous-couches d et f ont des propriétés magnétiques intenses car ces électrons sont fortement localisés ; en particulier, les lanthanides font des aimants particulièrement puissants en raison de leur moment magnétique induit par jusqu'à sept électrons non appariés — notamment le néodyme et le samarium. Il existe une méthode d'analyse spectroscopique sous champ magnétique analogue à la résonance magnétique nucléaire (RMN) qui fait intervenir le spin des électrons au lieu de celui des noyaux : la résonance paramagnétique électronique (également appelée de façon plus propre «résonance de spin électronique»).

    Le diamagnétisme, quant à lui, est un phénomène assez général dû au moment angulaire orbital des électrons et non au spin de ces derniers, qui consiste en l'apparition d'un champ magnétique de direction opposée à tout champ magnétique extérieur ; c'est un phénomène généralement de faible intensité, hormis quelques cas particuliers tels que, par exemple, l'or, le mercure, le bismuth et surtout les matériaux supraconducteurs (effet Meissner).

    - Fluorescence et phosphorescence
    Un électron d'un atome peut être excité par absorption d'un photon incident, ce qui le fait occuper une orbitale atomique d'énergie supérieure à celle de son état fondamental. De nombreuses molécules aromatiques ou présentant des liaisons π conjuguées sont susceptibles d'être ainsi excitées simplement par éclairage ; leur relaxation vers l'état fondamental se traduit alors par l'émission d'un ou plusieurs photons, selon deux mécanismes distincts :

    • La fluorescence consiste en l'émission, par un atome excité, d'un photon d'énergie inférieure au photon incident et correspondant exactement à la différence d'énergie entre l'état excité de l'électron et son état fondamental. Il s'agit par conséquent d'un phénomène quasi instantané, la durée de vie de l'état excité des matériaux usuellement employés pour leurs propriétés fluorescentes étant de l'ordre de 0,5 à 20 ns : la fluorescence cesse donc dès que l'éclairage cesse. La longueur d'onde émise est supérieure à celle de la lumière absorbée, ce qui permet par exemple d'obtenir des effets esthétiquement intéressants par éclairage ultraviolet de matériaux fluorescents émettant dans le spectre visible.

    • La phosphorescence diffère de la fluorescence en ce que la relaxation fait intervenir un état triplet entre les deux états singulets que sont l'état excité et l'état fondamental. Un électron excité dans un état singulet peut passer facilement dans un état triplet par conversion intersystème, mais s'y trouve alors «piégé» car il ne peut rejoindre l'état fondamental singulet qu'à travers des transitions «interdites» ; ces dernières sont néanmoins possibles du point de vue quantique, notamment grâce à des couplages spin-orbite, mais demeurent cinétiquement très défavorisées, ce qui explique que la phosphorescence soit un phénomène pouvant persister pendant, parfois, plusieurs heures.
    - Raies spectrales
    L'interaction d'atomes avec un rayonnement électromagnétique peut également se traduire par l'apparition de raies d'absorption ou d'émission à certaines longueurs d'onde particulières sur un spectre par ailleurs continu. Ces longueurs d'onde correspondent à l'énergie de transition entre couches électroniques et sous-couches électroniques : lorsqu'un atome est atteint par un photon ayant une énergie égale à l'une de ces transitions entre niveaux d'énergie électroniques, un électron peut absorber ce photon et passer à un niveau d'énergie supérieur, laissant une longueur d'onde déficitaire en photons, ce qui se matérialise dans le spectre par une raie d'absorption.

    Chaque atome, chaque ion, et même chaque molécule ou radical libre, possède ainsi une signature spectrale caractéristique, très employée par exemple en astrophysique pour détecter leur présence et déterminer leur concentration dans le milieu interstellaire, voire l'espace intergalactique : la disposition des raies spectrales, leur éventuel décalage (décalage vers le rouge), leur largeur, leur netteté et leur éventuelle séparation en plusieurs composantes (ce qu'on appelle leur structure fine) sont ainsi des paramètres riches d'informations sur le milieu traversé par le rayonnement analysé entre sa source et sa détection par les instruments de spectroscopie.

    • La présence d'un champ magnétique dans le milieu analysé peut être détectée par effet Zeeman, qui scinde une raie spectrale unique en trois composantes ou davantage, en raison de l'interaction du champ magnétique ambiant avec le moment magnétique de spin des électrons de l'atome : si plusieurs configurations électroniques partagent le même niveau d'énergie en l'absence de champ magnétique, cela cesse d'être le cas lorsqu'un champ magnétique est appliqué et chacune de ces configurations électroniques acquiert un niveau d'énergie légèrement différent des autres, leur multiplicité devenant alors visible sur le spectre d'absorption.


    • La vitesse radiale du milieu étudié par rapport à l'observateur peut être déterminée par le décalage des raies spectrales vers le rouge (éloignement) ou vers le bleu (rapprochement) par effet Doppler-Fizeau : c'est un résultat très utile en astronomie pour évaluer la distance d'un objet à partir de son redshift en appliquant la loi de Hubble.
    - États de la matière
    La matière baryonique peut exister à l'état solide, liquide ou gazeux selon sa température et sa pression : les transitions entre ces états surviennent à des niveaux de température et de pression directement en rapport avec les propriétés des atomes et de leurs arrangements moléculaires qui constituent chaque matériau. Les états solide et liquide sont qualifiés d’états condensés, tandis que les états liquide et gazeux sont qualifiés d’états fluides. Les cristaux liquides (une mésophase) sont un état intermédiaire entre solide et liquide.

    Il existe par ailleurs des états de la matière moins courants sur Terre et qui dérivent des précédents :


    • Les condensats de Bose-Einstein sont des gaz de bosons (les atomes sont aussi des bosons) piégés dans un puits de potentiel et refroidis à une température très proche du zéro absolu : dans ces conditions, une grande partie des bosons occupe l'état quantique de plus faible énergie dans le puits de potentiel, de sorte que leurs fonctions d'onde se recouvrent au point de révéler à l'échelle macroscopique des effets quantiques ponctuels (à l'échelle de l'atome) inobservables à température plus élevée.



     
  6. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113

    Composé chimique


    En chimie, un composé (ce qui est fautivement nommé composé chimique) est une substance chimique pure (composé moléculaire, assemblage ionique, composé intermétallique, complexe) composée d’atomes de deux ou plus éléments chimiques différents. Les atomes formant les assemblages des composés chimiques sont liés entre eux par des liaisons chimiques, qui peuvent être de différentes natures.

    Types de liaisons chimiques


    Des liaisons de plusieurs types peuvent réunir les atomes dans les composés. Elles sont classées en trois grandes catégories :

    • liaisons ioniques : ce sont des liaisons résultant de la perte d'un ou de plusieurs électrons de valence par un atome, et de la captation de ces électrons par un autre atome. Le premier atome devient alors chargé positivement (cation), et le second atome devient chargé négativement (anion). Ce type de liaisons s'établit généralement entre des éléments présentant une différence d’électronégativité très élevée (≥ 1,7 sur l’échelle de Pauling) ; c'est-à-dire un métal et un non-métal. Un exemple bien connu : le chlorure de sodium, NaCl ;

    • liaisons covalentes : dans ce cas, les atomes liés mettent en commun chacun un électron de valence afin de créer une paire d’électrons liants, partagée entre ces deux entités. Les éléments liés dans ce type de liaison présentent une différence d’électronégativité plus petite (< 1,7 sur l’échelle de Pauling) ou nulle ;

    • liaisons covalentes de coordination : dans ces liaisons, les électrons de valence servant à la formation de la liaison proviennent d’un même atome. Le doublet électronique assurant la liaison de coordination provient d'une entité nommée ligand. On appelle ce type de composé des complexes.

    Composés organiques et inorganiques


    Composés organiques : composés chimiques qui contiennent du carbone et pouvant généralement être synthétisés par les cellules du vivant. Certains carbures et composés font cependant exception, tels que le CO, le CO[SUB]2[/SUB], le CO[SUB]3[/SUB][SUP]2-[/SUP] et CN[SUP]-[/SUP].
    Composés inorganiques : tous les autres composés non-inclus dans la catégorie composés organiques.

    Législation


    De très nombreux composés peuvent avoir des effets positifs ou négatifs sur la santé ou l'environnement. Pour cette raison, ils font l'objet (production, transport, vente, transformation, étiquetage, gestion des déchets, etc.) de réglementations particulières, notamment encadrée par la directive REACH en Europe. En France, la loi Grenelle II[SUP]1[/SUP] stipule que dès janvier 2011, les producteurs, vendeurs ou importateurs de produits chimiques « ne pouvant pas présenter un risque significatif pour la santé et l’environnement » devront « prendre en charge, ou faire prendre en charge par des sociétés spécialisées, techniquement et financièrement la collecte et le traitement des déchets ménagers desdits produits (contenants et contenus). Ces produits doivent faire l’objet d’une signalétique appropriée afin d’éviter aux usagers de les faire collecter en mélange avec les déchets municipaux résiduels » ou de payer la taxe générale sur les activités polluantes.
     
  7. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113

    Liaison ionique



    Une liaison ionique (ou liaison électrovalente) est un type de liaison chimique qui peut être formé par une paire d'atomes possédant une grande différence d'électronégativité (par convention, supérieure à 1,7) typiquement entre un non-métal et un métal. Le métal donne un ou plusieurs électrons pour former un ion chargé positivement (cation). Le non-métal capte ces électrons pour former un ion chargé négativement (anion). Les deux ions formés possèdent fréquemment une configuration électronique de gaz rare (ils respectent la règle de l'octet). La liaison résulte de l'attraction entre le cation dérivant du métal et l'anion dérivant du non-métal.

    Par exemple, le sel de cuisine est du chlorure de sodium (NaCl). Quand le sodium (Na) réagit avec le chlore (gaz de dichlore, Cl[SUB]2[/SUB]), les atomes de sodium perdent un électron et les atomes de chlore gagnent un électron (la molécule de dichlore est d'abord dissociée). Les ions se combinent dans un rapport 1 : 1 pour former le sel de cuisine.


    [​IMG]

    Le fait d'enlever des électrons à des atomes est endothermique (les potentiels d'ionisation sont supérieurs à 0) : Les cations produits sont toujours de plus haute énergie que l'atome de départ. L'addition d'électrons aux atomes pour former des anions est au contraire un processus exothermique mais la stabilisation peut être nulle, faible ou très importante (voir l'article affinité électronique). L'attraction électrostatique entre des ions de charge opposée, est, elle, toujours favorable. Le bilan de la formation d'une liaison ionique est donc favorable pour la combinaison d'un atome perdant facilement un ou des électron(s) (potentiel d'ionisation faible) avec un autre atome possédant une affinité électronique élevée. Autrement dit la combinaison la plus favorable est celle d'un non-métal d'électronégativité élevée avec un métal d'électronégativité faible.

    Par extension, des ions polyatomiques (comme l'ammonium NH[SUB]4[/SUB][SUP]+[/SUP] ou le carbonate CO[SUB]3[/SUB][SUP]2-[/SUP]) peuvent se combiner avec des ions de charge opposée pour former des solides stables.

    Contrairement à la liaison covalente, la liaison ionique n'est pas dirigée ni localisée. Dans un cristal ionique les anions et les cations s'attirent mutuellement dans toutes les directions de l'espace. Il n'y a pas de paires d'atomes liés. Même si le chlorure de sodium s'écrit NaCl, cela ne signifie pas que des molécules de NaCl séparées les unes des autres existent

    La liaison ionique pure n'existe pas. Tous les composés présentent un degré de liaison covalente. Plus la différence d'électronégativité entre deux atomes est importante, plus la liaison est ionique. Les composés ioniques conduisent l'électricité à l'état fondu ou en solution. Ils possèdent généralement un point de fusion élevé et sont souvent solubles dans l'eau.

    Liste d'ions courants


    [TABLE="class: MsoNormalTable"]
    [TR]
    [TD] [TABLE="class: MsoNormalTable"]
    [TR]
    [TD="colspan: 3"]
    Cations
    [/TD]
    [/TR]
    [TR]
    [TD] Nom UICPA[/TD]
    [TD] Formule[/TD]
    [TD] Nom historique[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    Cations simples
    [/TD]
    [/TR]
    [TR]
    [TD] Aluminium[/TD]
    [TD] Al[SUP]3+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Baryum[/TD]
    [TD] Ba[SUP]2+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Béryllium[/TD]
    [TD] Be[SUP]2+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Césium[/TD]
    [TD] Cs[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Calcium[/TD]
    [TD] Ca[SUP]2+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Titane(III)[/TD]
    [TD] Ti[SUP]3+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Titane(IV)[/TD]
    [TD] Ti[SUP]4+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Chrome(II)[/TD]
    [TD] Cr[SUP]2+[/SUP][/TD]
    [TD] Chromeux[/TD]
    [/TR]
    [TR]
    [TD] Chrome(III)[/TD]
    [TD] Cr[SUP]3+[/SUP][/TD]
    [TD] Chromique[/TD]
    [/TR]
    [TR]
    [TD] Cobalt(II)[/TD]
    [TD] Co[SUP]2+[/SUP][/TD]
    [TD] Cobalteux[/TD]
    [/TR]
    [TR]
    [TD] Cobalt(III)[/TD]
    [TD] Co[SUP]3+[/SUP][/TD]
    [TD] Cobaltique[/TD]
    [/TR]
    [TR]
    [TD] Cuivre(I)[/TD]
    [TD] Cu[SUP]+[/SUP][/TD]
    [TD] Cuivreux[/TD]
    [/TR]
    [TR]
    [TD] Cuivre(II)[/TD]
    [TD] Cu[SUP]2+[/SUP][/TD]
    [TD] Cuivrique[/TD]
    [/TR]
    [TR]
    [TD] Gallium[/TD]
    [TD] Ga[SUP]3+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Or(I)[/TD]
    [TD] Au[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Or(III)[/TD]
    [TD] Au[SUP]3+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrogène[/TD]
    [TD] H[SUP]+[/SUP][/TD]
    [TD] (Proton)[/TD]
    [/TR]
    [TR]
    [TD] Fer(II)[/TD]
    [TD] Fe[SUP]2+[/SUP][/TD]
    [TD] Ferreux[/TD]
    [/TR]
    [TR]
    [TD] Fer(III)[/TD]
    [TD] Fe[SUP]3+[/SUP][/TD]
    [TD] Ferrique[/TD]
    [/TR]
    [TR]
    [TD] Plomb(II)[/TD]
    [TD] Pb[SUP]2+[/SUP][/TD]
    [TD] Plombeux[/TD]
    [/TR]
    [TR]
    [TD] Plomb(IV)[/TD]
    [TD] Pb[SUP]4+[/SUP][/TD]
    [TD] Plombique[/TD]
    [/TR]
    [TR]
    [TD] Lithium[/TD]
    [TD] Li[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Magnésium[/TD]
    [TD] Mg[SUP]2+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Manganèse(II)[/TD]
    [TD] Mn[SUP]2+[/SUP][/TD]
    [TD] Manganeux[/TD]
    [/TR]
    [TR]
    [TD] Manganèse(III)[/TD]
    [TD] Mn[SUP]3+[/SUP][/TD]
    [TD] Manganique[/TD]
    [/TR]
    [TR]
    [TD] Mercure(II)[/TD]
    [TD] Hg[SUP]2+[/SUP][/TD]
    [TD] Mercurique[/TD]
    [/TR]
    [TR]
    [TD] Nickel(II)[/TD]
    [TD] Ni[SUP]2+[/SUP][/TD]
    [TD] Nickeleux[/TD]
    [/TR]
    [TR]
    [TD] Nickel(III)[/TD]
    [TD] Ni[SUP]3+[/SUP][/TD]
    [TD] Nickelique[/TD]
    [/TR]
    [TR]
    [TD] Potassium[/TD]
    [TD] K[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Argent[/TD]
    [TD] Ag[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sodium[/TD]
    [TD] Na[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Strontium[/TD]
    [TD] Sr[SUP]2+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Étain(II)[/TD]
    [TD] Sn[SUP]2+[/SUP][/TD]
    [TD] Stanneux[/TD]
    [/TR]
    [TR]
    [TD] Étain(IV)[/TD]
    [TD] Sn[SUP]4+[/SUP][/TD]
    [TD] Stannique[/TD]
    [/TR]
    [TR]
    [TD] Zinc[/TD]
    [TD] Zn[SUP]2+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    Cations polyatomiques
    [/TD]
    [/TR]
    [TR]
    [TD] Ammonium[/TD]
    [TD] NH[SUB]4[/SUB][SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydronium[/TD]
    [TD] H[SUB]3[/SUB]O[SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Nitronium[/TD]
    [TD] NO[SUB]2[/SUB][SUP]+[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Mercure(I)[/TD]
    [TD] Hg[SUB]2[/SUB][SUP]2+[/SUP][/TD]
    [TD] Mercureux[/TD]
    [/TR]
    [/TABLE]
    [/TD]
    [TD] [TABLE="class: MsoNormalTable"]
    [TR]
    [TD="colspan: 3"]
    Anions
    [/TD]
    [/TR]
    [TR]
    [TD] Nom UICPA[/TD]
    [TD] Formule[/TD]
    [TD] Nom historique[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    Anions simples
    [/TD]
    [/TR]
    [TR]
    [TD] Arséniure[/TD]
    [TD] As[SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Azoture[/TD]
    [TD] N[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Bromure[/TD]
    [TD] Br[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Chlorure[/TD]
    [TD] Cl[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Fluorure[/TD]
    [TD] F[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrure[/TD]
    [TD] H[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Iodure[/TD]
    [TD] I[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Nitrure[/TD]
    [TD] N[SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Oxyde[/TD]
    [TD] O[SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Phosphure[/TD]
    [TD] P[SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sulfure[/TD]
    [TD] S[SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Peroxyde[/TD]
    [TD] O[SUB]2[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    Oxoanions
    [/TD]
    [/TR]
    [TR]
    [TD] Arsenate[/TD]
    [TD] AsO[SUB]4[/SUB][SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Arsenite[/TD]
    [TD] AsO[SUB]3[/SUB][SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Borate[/TD]
    [TD] BO[SUB]3[/SUB][SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Bromate[/TD]
    [TD] BrO[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hypobromite[/TD]
    [TD] BrO[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Carbonate[/TD]
    [TD] CO[SUB]3[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrogénocarbonate[/TD]
    [TD] HCO[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD] Bicarbonate[/TD]
    [/TR]
    [TR]
    [TD] Chlorate[/TD]
    [TD] ClO[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Perchlorate[/TD]
    [TD] ClO[SUB]4[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Chlorite[/TD]
    [TD] ClO[SUB]2[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hypochlorite[/TD]
    [TD] ClO[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Chromate[/TD]
    [TD] CrO[SUB]4[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Dichromate[/TD]
    [TD] Cr[SUB]2[/SUB]O[SUB]7[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Iodate[/TD]
    [TD] IO[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Nitrate[/TD]
    [TD] NO[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Nitrite[/TD]
    [TD] NO[SUB]2[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Phosphate[/TD]
    [TD] PO[SUB]4[/SUB][SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrogénophosphate[/TD]
    [TD] HPO[SUB]4[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Dihydrogénophosphate[/TD]
    [TD] H[SUB]2[/SUB]PO[SUB]4[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Permanganate[/TD]
    [TD] MnO[SUB]4[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Phosphite[/TD]
    [TD] PO[SUB]3[/SUB][SUP]3−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Sulfate[/TD]
    [TD] SO[SUB]4[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Thiosulfate[/TD]
    [TD] S[SUB]2[/SUB]O[SUB]3[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrogénosulfate[/TD]
    [TD] HSO[SUB]4[/SUB][SUP]−[/SUP][/TD]
    [TD] Bisulfate[/TD]
    [/TR]
    [TR]
    [TD] Sulfite[/TD]
    [TD] SO[SUB]3[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrogénosulfite[/TD]
    [TD] HSO[SUB]3[/SUB][SUP]−[/SUP][/TD]
    [TD] Bisulfite[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    Anions dérivant d'acides organiques
    [/TD]
    [/TR]
    [TR]
    [TD] Éthanoate[/TD]
    [TD] C[SUB]2[/SUB]H[SUB]3[/SUB]O[SUB]2[/SUB][SUP]−[/SUP][/TD]
    [TD] Acétate[/TD]
    [/TR]
    [TR]
    [TD] Méthanoate[/TD]
    [TD] HCO[SUB]2[/SUB][SUP]−[/SUP][/TD]
    [TD] Formiate[/TD]
    [/TR]
    [TR]
    [TD] Oxalate[/TD]
    [TD] C[SUB]2[/SUB]O[SUB]4[/SUB][SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Hydrogénooxalate[/TD]
    [TD] HC[SUB]2[/SUB]O[SUB]4[/SUB][SUP]−[/SUP][/TD]
    [TD] Bioxalate[/TD]
    [/TR]
    [TR]
    [TD="colspan: 3"]
    Autres anions
    [/TD]
    [/TR]
    [TR]
    [TD] Hydrogénosulfure[/TD]
    [TD] HS[SUP]−[/SUP][/TD]
    [TD] Bisulfure[/TD]
    [/TR]
    [TR]
    [TD] Tellurure[/TD]
    [TD] Te[SUP]2−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Amidure[/TD]
    [TD] NH[SUB]2[/SUB][SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Cyanate[/TD]
    [TD] OCN[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Thiocyanate[/TD]
    [TD] SCN[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [TR]
    [TD] Cyanure[/TD]
    [TD] CN[SUP]−[/SUP][/TD]
    [TD][/TD]
    [/TR]
    [/TABLE]
    [/TD]
    [/TR]
    [/TABLE]
     
  8. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113



    Liaison covalente


    Une liaison covalente est une liaison chimique dans laquelle chacun des atomes liés met en commun un électron d'une de ses couches externes afin de former un doublet d'électrons liant les deux atomes. C'est une des forces qui produit l'attraction mutuelle entre atomes.

    La liaison covalente implique généralement le partage équitable d'une seule paire d'électrons, appelé doublet liant. Chaque atome fournissant un électron, la paire d'électrons est délocalisée entre les deux atomes. Le partage de deux ou trois paires d'électrons s'appelle respectivement « liaison double » et « liaison triple ».

    Au contraire des liaisons ioniques où les atomes sont liés par attraction coulombienne non-directionnelle, les liaisons covalentes sont fortement directionnelles. En conséquence, les molécules liées par covalence tendent à adopter des formes caractéristiques possédant des angles de liaison spécifiques.

    Une liaison covalente est une liaison dans laquelle deux électrons de valence sont partagés entre deux non-métaux. Dans ce type de liaison, il doit y avoir une différence d’électronégativité inférieure à 1,7 sur l’Échelle de Pauling. Il y a formation d’une liaison covalente (sauf pour les liaisons de coordinence), lorsqu’il y a un recouvrement de deux orbitales atomiques ayant chacune un électron de valence. Grâce à ce recouvrement, il y aura la formation d’une seule et unique orbitale commune comme le montre la figure plus bas. Ce recouvrement d’orbitales atomiques conduit à la formation d’une orbitale moléculaire (non-illustrée). Il y a un partage d’électrons entre deux atomes d’hydrogène afin de former une seule molécule de dihydrogène. Cette liaison covalente est présentée comme étant : H-H. Seules les liaisons symétriques, homonucléaires, comme H-H ou Cl-Cl sont covalentes.


    Histoire


    L'idée de la liaison covalente remonte à Lewis, qui en 1916 décrit le partage de paires d'électrons entre atomes. Il présenta la «notation de Lewis» dans laquelle les électrons de valence (de la couche électronique externe) sont représentés comme des points autour des symboles atomiques. Les paires d'électrons situés entre les atomes représentent les liaisons covalentes et les paires multiples représentent des liaisons doubles ou triples.

    Tandis que l'idée des paires partagées d'électrons fournit une image qualitative efficace de la liaison covalente, la mécanique quantique est nécessaire pour comprendre la nature de ces liaisons et pour pouvoir prévoir les structures et les propriétés des molécules simples.

    En 1927, Walter Heitler et Fritz London furent crédités de la première explication quantique correcte de la liaison chimique, spécifiquement celle de la molécule de dihydrogène. Leur travail était basé sur le modèle de liaison de valence, qui suppose qu'une liaison chimique est formée lorsqu'il y a un bon recouvrement entre orbitales atomiques. Ces orbitales sont connues pour avoir des angles spécifiques les unes avec les autres. Le modèle de lien de valence put donc prévoir avec succès les angles de liaison observés dans des molécules simples.

    Aujourd'hui le modèle des liaisons de valence a été en grande partie supplanté par le modèle des orbitales moléculaires. Dans ce modèle, lorsque les atomes se rapprochent, leurs orbitales atomiques interagissent et forment alors un ensemble d'orbites moléculaires qui s'étend sur toute la molécule. La moitié de ces orbites tend à être des orbitales liantes et l'autre moitié anti-liantes. Les électrons des orbitales liantes provoquent la formation d'une liaison chimique, alors que ceux des orbitales anti-liantes tendent à les empêcher. La formation d'une liaison chimique n'est possible que lorsque les électrons occupant des orbitales liantes sont plus nombreux que ceux occupant des orbitales anti-liantes.

    L'ordre de liaison


    La différence entre le nombre de paires d'électrons contenues dans des orbitales liantes et anti-liantes détermine l'ordre de la liaison.

    Par exemple, dans une molécule diatomique, il y a une liaison simple qui se forme s'il y a un excès de deux électrons dans les orbitales liantes (H[SUB]2[/SUB]), une liaison double si quatre électrons sont en excès (O[SUB]2[/SUB]) et une liaison triple si cet excès est de six électrons (N[SUB]2[/SUB]). Les liaisons triples sont relativement rares dans la nature ; on en trouve par exemple dans le monoxyde de carbone CO.

    L'ordre de liaison n'a pas besoin d'être un nombre entier et les liaisons peuvent être délocalisées sur plus de deux atomes. Par exemple, dans le benzène, l'ordre de liaison entre deux atomes de carbone adjacent est de 3/2. Les électrons des orbitales liantes sont répartis uniformément sur chacun des 6 atomes de carbone : c'est la résonance. D'autres exemples sont les anions dérivés du dioxygène O[SUB]2[/SUB] : l'ajout d'électrons dans des orbitales π* antiliantes fait passer l'ordre de liaison de 2 à 3/2 pour le superoxyde O[SUB]2[/SUB][SUP]-[/SUP] et à 1 pour le peroxyde O[SUB]2[/SUB][SUP]2-[/SUP].

    Les longueurs et les énergies de dissociation des liaisons sont inversement proportionnelles à l'ordre de liaison : plus l'ordre de liaison est élevé, plus cette liaison est courte et forte.

    Lorsque les électrons sont délocalisés sur de nombreux atomes, on a une liaison métallique.


    Liaison covalente et électronégativité


    La liaison covalente se produit le plus fréquemment entre des atomes d'électronégativités semblables. La différence de niveau d'énergie entre les deux atomes n'est pas suffisante pour produire le transfert d'électrons d'un atome vers l'autre. Cependant, la répartition des électrons dans une liaison covalente entre atomes différents ne sera pas exactement symétrique. En effet, le point de gravité sera déplacé vers l'atome le plus électronégatif : la liaison covalente est polarisée. La direction de la polarisation est donnée par des charges partielles (Δ+ pour l'atome le moins électronégatif et Δ- pour le plus électronégatif). Plus la différence d'électronégativité est grande entre les atomes, plus les charges partielles sont élevées : la liaison est polarisée et a un caractère « ionique ». Les liaisons covalentes sont plus communes entre non-métaux, tandis que la liaison ionique est plus fréquente lorsqu'un ou chacun des deux atomes est un métal.

    Dans une liaison comme H-Cl, les électrons ne sont pas rigoureusement au centre de la liaison. En effet, le noyau du chlore (Z = 17) contient 17 protons tandis que l'hydrogène (Z = 1) n'en contient qu'un seul. Par conséquent, des électrons de valence placés entre les deux noyaux seront plus attirés par le noyau du chlore que par le noyau de l'hydrogène.
    L'électronégativité est ainsi une grandeur servant à décrire par quel atome les électrons seront le plus attirés.


    Enthalpie de liaison


    Dans une liaison covalente, plus le nombre de liaisons augmente, plus cela requiert de l'énergie pour les briser. Le bris d'une liaison covalente est un processus endothermique (qui requiert de l'énergie) tandis que la formation d'une liaison covalente est un processus exothermique. Pour calculer la variation d'enthalpie dans une réaction chimique, il est nécessaire de calculer la différence entre l'énergie requise pour rompre les liaisons dans les réactifs et l'énergie requise pour former les liaisons dans les produits :
    ΔH = ∑D (liaisons rompues des réactifs) - ∑D (liaisons formées des produits)
    D présente l'énergie de liaison par mole de liaison et est toujours affecté d'un signe positif.
    Par exemple, pour déterminer si la réaction H[SUB]2[/SUB] (g) + Cl[SUB]2[/SUB] (g) → 2 HCl (g) est exothermique ou endothermique à l'aide de la formule précédente :


    [​IMG]

    Cette réaction est exothermique : il est donc plus favorable de former HCl.

    Cas de la molécule de dihydrogène


    Il y a une variation de l'énergie potentielle du système lors du rapprochement de deux atomes d'hydrogène. L'énergie potentielle relative du système est égale à zéro, lorsque les deux atomes d'hydrogène sont isolés et extrêmement éloignés l'un de l'autre. Cette énergie potentielle nette est l'énergie qui se définit comme étant l'attraction et la répulsion entre des particules chargées qui sont, dans ce cas, les électrons (charge négative) et les protons (charge positive). Il y a une répulsion lorsque deux protons ou encore deux électrons essaient de s'approcher et il y a une attraction lorsqu'un électron et un proton essaient de s'approcher. Puisque naturellement, un système tend à atteindre un état d'énergie minimale, la formation d'une molécule de dihydrogène H[SUB]2[/SUB] avec deux atomes d'hydrogène isolés est favorable, puisque cela demande moins d'énergie. Lorsque les noyaux des atomes d'hydrogène se rapprochent l'un de l'autre, l'énergie potentielle diminue jusqu'au moment où la distance entre les noyaux est de 74 pm, ce qui correspond au niveau énergétique minimum du système. Si la distance entre les noyaux des atomes d'hydrogène devient inférieure à 74 pm, l'énergie potentielle augmente à cause des répulsions. Donc, une liaison covalente a des effets au niveau de l'énergie.

    Propriétés électroniques de la liaison covalente


    En utilisant les résultats de la mécanique quantique, il est possible de calculer la structure électronique, les niveaux d'énergie, les distances et les angles de liaisons, les moments dipolaires et le spectre électromagnétique de molécules simples avec une grande exactitude. Les distances et les angles de liaisons peuvent être calculés aussi précisément qu'elles peuvent être mesurées (quelques pm pour les distances et quelques degrés pour les angles).

    Pour les petites molécules, les calculs concernant les niveaux d'énergie sont suffisamment précis pour qu’ils puissent être utilisés afin de déterminer leur chaleur de formation et l'énergie de leur barrière d'activation cinétique.



    Liaison covalente de coordination

    Une liaison covalente de coordination (anciennement connue sous le nom de liaison dative, maintenant obsolète) est une description de la liaison covalente entre deux atomes pour lesquels les deux électrons partagés dans la liaison proviennent du même atome. La distinction par rapport à une liaison covalente ordinaire est artificielle, mais la terminologie est fréquente dans les manuels, et tout particulièrement ceux traitant des composés de coordination. Une fois les liaisons formées par ce biais, sa force et sa description n'est pas différente des autres liaisons polaires.

    Les liaisons covalentes de coordination sont évoquées lorsqu'une base de Lewis (donneur d'électrons) fournit une paire d'électrons à un acide de Lewis (accepteur d'électrons) afin de donner un adduit. Le processus de formation d'une liaison dative est appelé coordination. Le donneur d'électrons acquiert une charge positive, l'accepteur d'électrons acquérant dans le même temps une charge formelle négative.

    Exemples


    De manière classique, tout composé contenant une paire d'électrons non appariés peut former une liaison de coordination. La liaison dans divers composés chimiques peut être décrite comme une liaison covalente de coordination.

    • le monoxyde de carbone (CO) peut être considéré comme présentant une liaison de coordination et deux liaisons covalentes « normales » entre les atomes de carbone et d'oxygène. Cette description très inhabituelle illustre la flexibilité de ce type de description. Ainsi dans le CO, le carbone est l'accepteur d'électron et l'oxygène le donneur d'électron.
    • l'ion ammonium (NH[SUB]4[/SUB][SUP]+[/SUP]), peut être perçu comme comprenant quatre liaisons covalentes de coordination entre les protons (ions H[SUP]+[/SUP]) et le trianion azote N[SUP]3-[/SUP].
    • le dichlorure de béryllium (BeCl[SUB]2[/SUB]) est décrit comme déficitaire en électrons dans le sens où les espèces triatomiques (qui existent en phase gazeuse) entourent les centres Be avec quatre électrons de valence. Lorsqu'ils sont traités par du chlore en excès, les ions Be[SUP]2+[/SUP] se lient avec quatre ions chlorure pour former l'anion tétrachlorobéryllate, BeCl[SUB]4[/SUB][SUP]2-[/SUP], dans lequel tous les ions respectent la règle de l'octet pour les électrons.
    D'autre part, les liaisons de coordination sont très courantes dans les molécules du vivant ayant une partie métallique : dans les chélats, dans les doigts de Zinc (dans des molécules interagissant avec l'Adn comme le récepteur à l'ecdysone) ainsi que dans tous les composés tétrapyrroliques ou à bases de pyrrole telle que l'hémoglobine, la myoglobine où le phytocrome dont les liaisons de coordination sont fondamentales pour la réalisation de leurs fonctions biologiques.

    Composés de coordination


    La notion de liaison de coordination est couramment utilisée pour décrire les complexes de coordination, et particulièrement ceux impliquant des ions métalliques. Dans de tels complexes, plusieurs bases de Lewis donnent leurs paires d'électrons « libres » à un autre cation métallique dépourvu, qui agit comme un acide de Lewis et accepte donc les électrons. Des liaisons de coordination se forment et le composé résultant est appelé « complexe de coordination », et les donneurs d'électrons sont appelés ligands. Une description plus utile de la liaison dans les composés de coordination est fournie par la théorie du champ de ligands, qui traite des orbitales moléculaires pour la description des liaisons dans de tels composés polyatomiques.

    De nombreux composés chimiques peuvent servir de ligands, comme ceux contenant des ions oxygène, soufre, azote et halogènes. Le ligand le plus commun est l'eau (H[SUB]2[/SUB]O, ligand aqua ), qui forme des complexes de coordination avec des ions métalliques (comme l'ion hexaaquacuivre(II), [Cu(H[SUB]2[/SUB]O)[SUB]6[/SUB]][SUP]2+[/SUP]). L'ammoniac (NH[SUB]3[/SUB]) (ligand ammine, dans ce contexte) est aussi un ligand commun, comme certains anions, spécialement les ions fluorure (F[SUP]-[/SUP]), chlorure (Cl[SUP]-[/SUP]), cyanure (CN[SUP]-[/SUP]), ainsi que des molécules neutres tels le monoxyde de carbone (CO) et les phosphines (PR[SUB]3[/SUB]).


    VOIR AUSSI/

     
  9. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113


    Molécule


    Une molécule est une structure de base de la matière. C'est l'assemblage chimique électriquement neutre d'au moins deux atomes, qui peut exister à l'état libre, et qui représente la plus petite quantité de matière possédant les propriétés caractéristiques de la substance considérée. Les molécules constituent des agrégats atomiques liés par des forces de valence (liaisons covalentes) et elles conservent leur individualité physique. Des forces plus faibles, telles les liaisons hydrogène et celles de type van der Waals, les maintiennent à proximité les unes des autres à l'état liquide et solide.

    L'assemblage d'atomes constituant une molécule n'est pas définitif, il est susceptible de subir des modifications, c’est-à-dire de se transformer en une ou plusieurs autres molécules ; une telle transformation est appelée réaction chimique. En revanche, les atomes qui la constituent sont des assemblages (de particules) beaucoup plus stables, qui se conservent durant une réaction chimique car la transformation d'atomes, appelée transmutation, nécessite des apports d'énergie beaucoup plus importants faisant l'objet des réactions nucléaires.

    La composition chimique d'une molécule est donnée par sa formule chimique. Exemples :

    Histoire du concept et étymologie

    Le nom «molécule» provient du latin scientifique molecula, diminutif du nom latin moles, se traduisant par « masse ».

    Le concept de molécule a été présenté la première fois en 1811 par Amedeo Avogadro, qui a su surmonter la confusion faite à cette époque entre atomes et molécules, en raison des lois des proportions définies et multiples de John Dalton (1803-1808).

    L'analyse d'Avogadro a été acceptée par beaucoup de chimistes, à des exceptions notables (Boltzmann, Maxwell, Gibbs). Mais l'existence des molécules est restée en discussion ouverte dans la communauté scientifique jusqu'au travail de Jean Perrin (1911) qui a alors confirmé expérimentalement l'explication théorique du mouvement brownien en termes d'atomes proposée par Albert Einstein (1905). Jean Perrin a également recalculé le nombre d'Avogadro par plusieurs méthodes.

    Types particuliers de molécules


    • Une molécule élémentaire ou homonucléaire est une molécule constituée d'un seul type d'atomes, par exemple le dioxygène (O[SUB]2[/SUB]). Lorsqu’une molécule est composée de plusieurs types d’atomes, elle est dite hétéronucléaire.


    • Une molécule hydrophile ou hydrophobe est une molécule qui a de l'affinité pour l'eau ou qui fuit l'eau (non soluble ou non miscible avec l'eau), respectivement ; comme par exemple l'acide oléique, molécule hydrophobe qui fuit donc l'eau.

    • Une molécule amphiphile est une molécule ayant une ou plusieurs parties hydrophiles et une ou plusieurs parties hydrophobes.

    • En appliquant strictement la définition, les ions polyatomiques ne sont pas des molécules. En revanche, les zwitterions, globalement neutres mais possédant des charges de signe opposé dans différentes parties de leur structure, sont des molécules.

    • Une molécule marquée est une molécule dans laquelle un ou plusieurs atomes sont remplacés par un de leurs isotopes. Cette pratique est courant avec des isotopes radioactifs, dans un but médical.



    • Molécule médicamenteuse : on appelle abusivement molécule la substance active d'un médicament (par opposition à son nom de marque), quand bien même la substance active est composée de plusieurs espèces chimiques différentes (exemple : cas de la gentamicine). Il est préférable de parler de substance active ou de principe actif.
    Caractéristiques

    - Ordonnancement

    Les molécules d'un corps sont en agitation permanente (sauf au zéro absolu). Cette agitation, appelée mouvement brownien, a été décrite la première fois par Robert Brown en 1821 dans les liquides (mais expliquée presque 100 ans plus tard).

    • À l'état gazeux, les molécules sont très espacées, très agitées, avec des mouvements désordonnés provoqués par les chocs entre elles ou avec les corps solides avec lesquelles elles sont en contact (parois).

    • À l'état liquide, l'espace entre les molécules est beaucoup plus restreint, l'agitation beaucoup plus lente.

    • À l'état solide, les molécules sont rangées selon un empilement, régulier ou non, et vibrent autour d'une position moyenne.
    La température d'un corps donne une indication du degré d'agitation des molécules.
    Les forces d'interaction de très faible intensité qui s'exercent à distance entre les molécules, appelées forces de van der Waals, conditionnent ces arrangements et par conséquent les propriétés physiques des composés moléculaires.
    Ainsi, par exemple, les propriétés physiques exceptionnelles de l'eau sont dues pour beaucoup aux liaisons hydrogène.

    - Stabilité
    Les molécules sont des ensembles a priori électriquement neutres, dans lesquels les atomes sont liés entre eux majoritairement par des liaisons covalentes (il existe de nombreux exemples d'assemblages supra-moléculaires par liaisons de type van der Waals, hydrogène ou ionique), où apparaissent parfois des dissymétries électroniques pouvant aller jusqu'à donner des ions par solvatation (solvants polaires). Dès lors, on doit conclure que le dihydrogène (H[SUB]2[/SUB]), le dichlore, le difluor et tant d'autres gaz diatomiques, sont électriquement neutres. Ce qui laisse entendre que lorsqu'ils sont isolés, ils sont zérovalents, pour respecter l'équivalence qu'il doit y avoir dans toute équation équilibrée en charges et globalement neutre comme : 2 H[SUB]2[/SUB] + O[SUB]2[/SUB] = 2H[SUB]2[/SUB]O. Ici, dans la partie des réactifs, le dihydrogène et le dioxygène sont des molécules isolées et donc n'ont pas de charge propre, comme H[SUB]2[/SUB]O (bien que molécule polaire). L'équation chimique vérifie donc la neutralité de la charge globale.

    La forme et la taille d'une molécule (ou de l'une de ses parties) peut jouer un rôle dans son aptitude à réagir. La présence de certains atomes ou groupes d'atomes à l'intérieur d'une molécule joue un rôle majeur dans sa capacité à se rompre ou à fixer d'autres atomes issus d'autres corps, c’est-à-dire à se transformer pour donner naissance à d'autres molécules.

    Les différents modes de représentation des molécules sont destinés à expliciter les différents sites réactifs ; certains enchaînements d'atomes, appelés groupes fonctionnels, produisent ainsi des similitudes de propriétés, tout particulièrement dans les composés organiques.

    - Les macromolécules et polymères
    Les molécules possédant au moins plusieurs dizaines d'atomes sont appelées macromolécules ou polymères.

    Exemples :

    • les protéines, les lipides, les sucres, les acides nucléiques tels l'ADN et autres biomolécules de grandes tailles sont également des macromolécules où la grande variété des liaisons chimiques internes induisent une réactivité chimique souvent très sélective jouant un rôle majeur dans l'activité biologique des êtres vivants ;
    • les polyoléfines telles le polyéthylène (polymère synthétique) sont constituées d'enchaînements -C-C- ; le nombre d'atomes de carbone des chaînes peut atteindre plusieurs dizaines de milliers (correspondant à un degré de polymérisation élevé), d'où des propriétés physiques particulières.
    Les corps non moléculaires

    Il existe deux autres grandes catégories de corps purs non moléculaires :

    • les métaux, qui contiennent une seule sorte d'atomes tous liés les uns aux autres par mise en commun globale et délocalisée d'électrons, appelée liaison métallique ;
    • les composés ioniques qui regroupent des atomes (ou groupement d'atomes) dont certains supportent un excès d'électrons (anions) répartis parmi d'autres acceptant un déficit d'électrons (cations). La cohésion de l'ensemble est alors assurée par les forces électriques présentes à l'origine des liaisons ioniques.
    Dans le milieu interstellaire

    Les couches externes des étoiles contiennent, malgré les températures extrêmes qui y règnent, des molécules, telles le monoxyde de carbone. Les comètes et les atmosphères gazeuses des planètes contiennent une plus grande variété de molécules.
    Dans le milieu interstellaire, où la probabilité de rencontre entre atomes est très faible, il existe des assemblages instables (radicaux) d'une diversité restée longtemps inconnue qui est peut-être à l'origine des premières molécules du monde du vivant.

    Le niveau moléculaire


    La structure des organismes biologiques qui constituent la biosphère peut être décomposée en plusieurs niveaux d'organisation : atomique, moléculaire, cellulaire, tissulaire, organique, des systèmes, et enfin celui de l'organisme dans sa totalité fonctionnelle.
    L'étude scientifique du vivant se fait par des recherches sur les éléments de chacun de ces niveaux, puis par la compréhension des interactions entre ces différents niveaux (voir l'article Méthode scientifique).

    L'étude du niveau des molécules permet de comprendre le fonctionnement de la cellule, qui est l'unité fonctionnelle élémentaire du vivant.


     
  10. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113


    Représentation des molécules


    Les représentations de molécules sont utilisées en chimie pour décrire les molécules (ou, par extension, d'autres espèces chimiques) et leurs structures Ces représentations graphiques permettent de décrire les liaisons moléculaires, le nombre et le type d'atomes qui composent une molécule, sa forme dans l'espace ou simplement de décrire sommairement la molécule de manière simple et rapide. La plupart de ces représentations sont surtout utilisées en chimie organique ou en biochimie.

    Formule, représentation et projection


    Différents termes sont utilisés pour désigner les représentations graphiques de molécules : on parle ainsi de formule brute, de représentation de Cram ou de projection de Fischer.

    • Les formules sont utilisées pour décrire le nombre et le type d'atomes dans la molécule (formule brute), montrer comment ils sont liés entre eux (formule de Lewis, développée...). Les formules servent surtout à représenter simplement et sommairement les molécules et sont donc souvent utilisées dans les équations chimiques.
    • La représentation de Cram permet de décrire directement la structure tridimensionnelle d'une molécule, par un schéma qui permet de visualiser la molécule telle qu'elle existe dans l'espace.
    • Les projections de molécules ne les représentent pas directement : les molécules sont projetées et aplaties sur deux dimensions (une feuille) de différentes manières selon la projection employée. Elles permettent de représenter indirectement des parties de molécules telles qu'elles existent dans l'espace en appliquant des règles strictes de projection.
    Notion de liaison chimique

    Ce paragraphe n'a pas pour but d'expliquer en détail ce qu'est une liaison chimique, ni de lister toutes les liaisons chimiques existantes. Plus d'informations à ce sujet dans l’article liaison chimique

    Dans cet article nous parlerons surtout des liaisons covalentes et des liaisons ioniques. Dans la réalité, une liaison chimique est très rarement purement covalente (c'est le cas d'une liaison entre deux atomes identiques comme par exemple dans la molécule de dihydrogène) ou purement ionique. La liaison réelle est un mélange de ces deux caractères.

    Liaison covalente
    Lorsque deux atomes sont liés par covalence il y a mise en commun d'un ou plusieurs doublets d'électrons, c'est-à-dire que deux (ou plus) électrons vont appartenir en même temps aux deux atomes. Il existe deux types de liaisons de covalence :

    • La covalence pure : il y a mise en commun d'un doublet d'électrons, chaque atome apporte un électron initialement à l'état célibataire
    • La covalence dative : il y a mise en commun d'un doublet d'électrons, un seul des deux atomes apportera le doublet
    Liaison ionique
    Les liaisons ioniques sont dues aux différences d'électronégativité (capacité à attirer les électrons) des atomes présents dans la molécule.

    Pour comprendre ce qu'est une liaison ionique il faut considérer deux atomes liés entre eux. Si l'un est plus électronégatif alors il attirera les électrons de l'autre. L'atome plus électronégatif sera alors un peu chargé négativement, l'autre un peu positivement. Cette différence de charge créera une force électrostatique qui attirera les deux atomes (une charge positive et une charge négative s'attirent). Si cette différence d'électronégativité est très importante alors on parle de liaison ionique. La plupart des liaisons mettant en jeu deux éléments différents sont en partie ioniques, le caractère ionique étant généralement d'autant plus important que la différence d'électronégativité est importante.

    Représentations non spécifiques à la chimie organique


    Ces représentations sont applicables à toutes les molécules et tous les ions existants. Elles sont assez simples d'utilisation.

    Formule brute
    La formule brute renseigne uniquement sur la composition chimique des molécules (ou des ions), c'est-à-dire sur le nombre et le type d'atomes qui les composent, et sur la charge électrique des composés si ce sont des ions. Elle ne renseigne pas sur l'agencement spatial des atomes, ni sur le type des liaisons chimiques.

    Pour écrire une formule brute on indique l'élément chimique à l'aide de son symbole (cf. tableau périodique des éléments), et la quantité de cet élément par un nombre en indice à la droite de l'élément concerné. La charge électrique du composé, s'il en a une, est indiquée en Exposant à la fin de la formule. Le nombre de charges élémentaires est indiqué par un nombre suivi d'un + si le composé est chargé positivement (s'il lui manque un ou plusieurs électrons), ou d'un - si le composé est chargé négativement (s'il a un excès d'électrons).

    - Exemples

    Tous ces exemples ne seront pas repris dans chaque section.

    • Chimie inorganique
      • L'eau : H[SUB]2[/SUB]O
      • L'acide sulfurique : H[SUB]2[/SUB]SO[SUB]4[/SUB]
      • L'ion oxonium : H[SUB]3[/SUB]O[SUP]+[/SUP] (globalement ce composé est chargé positivement, sa charge est de +e, avec e la charge élémentaire)
      • L'ion tétraaminecuivre (II) : Cu(NH[SUB]3[/SUB])[SUB]4[/SUB][SUP]2+[/SUP] (les parenthèses signifient qu'il y a quatre molécules d'ammoniac liées à l'atome central de cuivre)


    • Chimie organique
      • Le glucose : C[SUB]6[/SUB]H[SUB]12[/SUB]O[SUB]6[/SUB]
      • L'éthanol : C[SUB]2[/SUB]H[SUB]6[/SUB]O ou C[SUB]2[/SUB]H[SUB]5[/SUB]OH (cette deuxième version de la formule brute, qui ne respecte pas exactement les règles d'écriture exposées ci-dessus, est utilisée pour mettre en avant la fonction alcool)
      • Le benzène : C[SUB]6[/SUB]H[SUB]6[/SUB]
      • L'acétone : C[SUB]3[/SUB]H[SUB]6[/SUB]O

    Formule de Lewis

    La formule de Lewis a été créée par Gilbert Newton Lewis au début du XX[SUP]e[/SUP] siècle. Elle permet de représenter les liaisons assemblant les atomes entre eux (liaisons covalentes et ioniques), mais aussi les électrons de valence ne participant pas aux liaisons. Le modèle de Lewis permet de représenter la structure d'une molécule, mais ne permet pas de montrer la forme de la molécule dans l'espace.
    La représentation de Lewis est basée sur des règles simples. De ce fait elle ne permet pas de décrire toutes les molécules, notamment les complexes de métaux (comme la rouille).

    - Formule de Lewis de l'atome
    La méthode décrite ci-dessous fonctionne globalement pour les éléments des trois premières périodes (ligne du tableau) du tableau périodique des éléments

    Pour établir la formule de Lewis d'un atome il faut établir sa configuration électronique. Pour cela il existe une méthode simple :

    • Définir le nombre d'électrons de la couche de valence de l'élément. Pour cela on compte la place de l'élément en partant de la gauche du tableau. L'hydrogène a ainsi un électron dans sa couche de valence, le carbone en a quatre, l'azote cinq et le chlore sept.
    • Définir le nombre d'électrons célibataires et de doublets non-liants de l'élément. Il suffit pour cela de savoir que :
      • si un élément a au plus quatre électrons dans sa couche de valence, alors ils sont tous célibataires ; ainsi l'hydrogène a un électron célibataire, le carbone en a quatre, [​IMG][​IMG]
      • lorsqu'il y a plus de quatre électrons de valence, tous les électrons se rajoutant aux quatre célibataires forment un doublet non liant ; le chlore a trois doublets non-liants et un électron célibataire et l'azote un doublet non liant et trois électrons célibataires. Voir la pièce jointe 4934 [​IMG]

    Une fois la configuration électronique de l'atome établie, on représente sa formule de Lewis. L'élément est représenté par son symbole. Autour de ce symbole on place les électrons célibataires, représentés par un point, et les doublets non-liants, représentés par un trait.
    - Formule de Lewis de la molécule
    Pour les molécules, la formule de Lewis est basée sur des règles empiriques simples (qu'il n'est pas toujours possible de respecter), notamment la règle de l'octet ou du duet.
    La règle de l'octet implique que chaque atome, de la deuxième et troisième période, doit s'approcher de la configuration électronique des gaz rares (de grande stabilité) en ayant huit électrons dans sa couche de valence. La règle du duet ne s'applique qu'à l'atome d'hydrogène, celui-ci doit avoir deux électrons dans sa couche de valence.
    Pour établir le modèle de Lewis d'une molécule il faut d'abord établir la formule de Lewis de chacun de ses atomes. Ensuite on relie ces atomes de manière à ce que chacun d'eux respecte la règle de l'octet ou du duet. Pour cela on met d'abord en commun les électrons célibataires de chaque atome. Puis si cela ne suffit pas, on utilise des liaisons de covalence dative ou on divise certains doublets non liants pour obtenir deux électrons célibataires. (Voir les exemples)


    - Exemples

    • [​IMG] Ici, les électrons célibataires sont simplement mis en commun, une seule possibilité.


    • [​IMG]
    Cet ion est chargé positivement, il lui manque donc un électron, d'où le rectangle vide sur l'oxygène qui représente un électron manquant. Pour former cet ion, un des deux doublets non liant de l'oxygène a été cassé, en résulte deux électrons célibataires, l'un forme un doublet avec le troisième hydrogène, l'autre est absent ce qui correspond à la charge positive. Une molécule dont la formule de Lewis comporte un électron célibataire est appelée « radical ». Cette configuration est très instable, les radicaux sont donc très réactifs.

    Molécule d'éthanol:

    • [​IMG] exemple de composé organique.


    Modèle de l'acide sulfurique:


    Formule développée plane

    La formule développée plane permet de représenter de manière très simple et rapide la structure d'une molécule, ainsi que les liaisons chimiques. Mais elle ne permet pas de représenter la forme de la molécule dans l'espace.
    La formule développée plane est en quelque sorte une formule de Lewis simplifiée. En effet, la représentation est quasiment identique, mais on ne montre pas les doublets non-liants pour simplifier et alléger l'écriture. Généralement les liaisons sont représentées à 90°, mais sont parfois représentées sous des angles différents pour s'approcher de la structure réelle de la molécule dans l'espace (par exemple 120° autour d'une double liaison carbone-carbone).

    - Exemples



    • Molécule de butane : [​IMG]

    Représentation de Cram

    La représentation de Cram permet de montrer la forme dans l'espace d'une molécule, et sa structure. En revanche elle ne représente pas les liaisons chimiques (pas de différence en liaison multiple et liaison simple).
    Pour illustrer la forme de la molécule les différentes directions que peuvent prendre ses liaisons chimiques sont codifiées de cette manière :

    • une liaison dans le plan (de la feuille) est représentée par un trait simple
    • une liaison qui est dirigée vers le lecteur est représentée par un triangle plein, pointé vers le plan
    • une liaison qui s'éloigne du lecteur est représentée par un triangle hachuré pointé vers le plan
    On représente de manière plus précise l'orientation des liaisons chimique en faisant varier les angles entre les liaisons pour coller au plus près à la réalité. Cette représentation permet notamment de visualiser les atomes de carbone asymétriques et de déterminer si une molécule est chirale.
    - Exemple : [​IMG]
    Représentation de Cram de la molécule d'éthanol.


    Représentations spécifiques à la chimie organique


    Ces représentations sont spécifiques à la chimie organique car elles utilisent des règles spécifiques aux liaisons carbone-carbone ou carbone-hydrogène.

    Formule semi-développée (plane)
    La formule semi-développée, comme son nom l'indique, est une forme condensée de la formule développée. On ne représente plus les liaisons Carbone-Hydrogène qui sont condensées sous forme de : CH[SUB]n[/SUB] (avec n le nombre d'atomes d'hydrogène liés à l'atome de carbone). On représente les liaisons carbone-carbone et on distingue liaison simple et liaisons multiples.

    - Exemples


    • CH[SUB]3[/SUB]-CH[SUB]2[/SUB]OH, la molécule d'éthanol, de la famille des alcools.
    • CH[SUB]3[/SUB]-CO-CH[SUB]3[/SUB], la molécule d'acétone, de la famille des cétones.

    Formule topologique
    La formule topologique est une manière simplifiée et rapide de représenter la structure d'une molécule organique.

    On ne représente plus les atomes de carbone ni les atomes d'hydrogène portés par ces derniers. Les atomes d'hydrogène portés par des hétéroatomes (éléments autres que le carbone et l'hydrogène) sont représentés. Les liaisons carbone-carbone sont représentées par un trait oblique. Dans une formule topologique les atomes de carbone sont ainsi situés à l'intersection de deux segments. On fait la distinction entre liaisons multiples et liaisons simples : une liaison simple sera représentée par un trait, une liaison double par deux segments parallèles.

    On représente la liaison entre les hétéroatomes, ou les groupes fonctionnels, et les carbones auxquels ils sont liés par un segment; on place le groupe fonctionnel, ou l'hétéroatome, à l'extrémité de ce segment. Les atomes d'hydrogène portés par les atomes de carbone n'étant pas représentés, un segment dont une extrémité n'est liée à aucun groupe fonctionnel correspond en fait à -CH[SUB]3[/SUB].

    - Exemples
    Voir la pièce jointe 4933
    formule topologique de la molécule d'éthanol

    [​IMG]
    formule topologique de la molécule de mémantine


    Formule topologique de quelques polymères importants
    [​IMG]

    Projection de Newman
    La projection de Newman est très utile pour étudier les différentes conformations (on passe d'un conformère à un autre par rotation autour d'une liaison simple carbone-carbone) d'un composé organique. Cette projection est généralement utilisée uniquement avec des carbones tétravalents (liés à quatre autres atomes).

    Pour représenter une molécule dans une projection de Newman il faut regarder la molécule dans l'axe d'une liaison simple carbone-carbone, on ne représente pas ces deux carbones dans une projection de Newman, mais les liaisons.

    Les liaisons du carbone au premier plan sont représentées par trois segments partant du même point, les angles entre chacun de ces segments sont de 120° comme dans la réalité. Le carbone en arrière plan est représenté par un cercle sur lequel on place les trois liaisons restantes. (voir l'exemple)

    Cette représentation permet de visualiser aisément les effets d'interactions stériques entre des groupements portés par deux carbones adjacents. Elle permet également de déterminer facilement la conformation Z ou E de l'alcène résultant d'une réaction d'élimination.
    - Exemple[​IMG]
    Schéma descriptif du passage de la représentation de Cram à la représentation de Newman pour la molécule d'éthanol.

    Projection de Fischer
    La projection de Fischer est surtout utilisée pour représenter les sucres et les acides aminés. Elle fut inventée par Hermann Emil Fischer.

    On ne représente pas les atomes de carbone, ils sont situés à l'intersection des segments horizontaux et du trait vertical. La chaîne carbonée est représentée par la ligne verticale de manière à ce que les liaisons représentées sur la verticale s'éloignent du lecteur. Les liaisons représentées sur l'horizontale sortent du plan de la feuille vers le lecteur (voir l'exemple). Le carbone le plus oxydé se trouve en début de chaîne (en haut ici C=O).

    Cette représentation permet de différencier facilement les énantiomères chiraux L ou D.

    - Exemple
    [​IMG]
    Schéma du passage de la représentation de Cram à la projection de Fischer pour la molécule de D-Glucose
    Projection de Haworth
    La projection de Haworth permet de représenter la structure cyclique des oses (ou monosaccharides) avec une simple perspective tridimensionnelle.
    Dans cette projection, on ne représente ni les atomes de carbone ni ceux d'hydrogène mais par contre, les liaisons carbone - carbone sont représentées par un trait. De plus, les liaisons les plus proches du lecteur sont en gras.


    - Exemple [​IMG] Projection de Haworth du α-D-glucopyranose


     
  11. RedEye

    RedEye - أبو عبدالرحمن - Membre du personnel

    J'aime reçus:
    4153
    Points:
    113
    de passage bent 3ommi, merci bcp, fekkartini f ayam chimie...ihh ya zamane je l'aimais tant

    daba l7aja lwa7iida elli 3a9el 3liha hia hadi : "rien ne se perd, rien ne se crée, tout se transforme"
     
  12. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113


    Oui, ça devait être vraiment intéressant et puis, au fur et à mesure que je poste les sujets, j'apprends beaucoup de choses que j'ignore.
    Sauf pour les formules mathématiques ou autres... c'est du chinois pour moi hhh :p
    baraka 3lya gher la "chimie" dial la cuisine car elle est composée d'ingrédients divers mdrrr :lool:
    Merci à toi aussi :)


     
  13. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113


    Molécule diatomique


    Les molécules diatomiques sont des molécules constituées uniquement de deux atomes, soit de même ou de différents éléments chimiques. Le préfixe di- signifie deux en grec.
    Description et présence dans la nature

    D’après le livre de Huber et Herzberg, qui fait la liste des centaines de molécules diatomiques qui ont été détectées par spectroscopique dans la liste de molécules détectées dans le milieu interstellaire. Toutefois, on trouve peu de molécules diatomiques différentes sur Terre en dehors des laboratoires.

    Environ 99 % de l’atmosphère de la Terre est composée de molécules diatomiques, en particulier l’oxygène (21 %) et l'azote (78 %), le pour-cent restant étant majoritairement de l’argon (0,9340 %). L’abondance naturelle de l’hydrogène dans l’atmosphère de la terre est seulement de l’ordre de quelques parties pour million, mais H[SUB]2[/SUB] est, en fait, la molécule la plus abondante observée dans la nature, dominant la composition des étoiles.

    Les éléments composés de molécules diatomique, sous condition standard de laboratoire de 1 bar et 25 [SUP]o[/SUP]C, comprennent l’hydrogène (H[SUB]2[/SUB]), azote (N[SUB]2[/SUB]), oxygène (O[SUB]2[/SUB]), et les halogènes : fluor (F[SUB]2[/SUB]), chlore (Cl[SUB]2[/SUB]), brome (Br[SUB]2[/SUB]), iode (I[SUB]2[/SUB]), et, peut-être, l'astate (At[SUB]2[/SUB]).
    Beaucoup d’autres molécules diatomiques sont possibles, comme les métaux chauffés à leur état gazeux. Plusieurs autres molécules diatomiques sont instables et hautement réactives, comme le diphosphore. Plusieurs composés chimiques sont faits de molécules diatomiques, comme le CO et le HBr. Si une molécule diatomique est composée de deux atomes du même élément, par exemple H[SUB]2[/SUB] et O[SUB]2[/SUB], elle est dite homonucléaire, sinon, on parle de molécule hétéronucléaire, comme, par exemple, avec le CO ou NO. Le lien dans une molécule diatomique homonucléaire est non-polaire et pleinement covalente.


    Liste de molécules détectées dans le milieu interstellaire
    http://fr.wikipedia.org/wiki/Liste_de_molécules_détectées_dans_le_milieu_interstellaire
     
  14. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113

    Structure des protéines


    La structure des protéines est la composition en acides aminés et la conformation en trois dimensions des protéines. Elle décrit la position relative des différents atomes qui composent une protéine donnée. Les protéines sont des macromolécules de la cellule, dont elles constituent la «boîte à outils», lui permettant de digérer sa nourriture, produire son énergie, de fabriquer ses constituants, de se déplacer, etc. Elles se composent d'un enchaînement linéaire d'acides aminés liés par des liaisons peptidiques. Cet enchaînement possède une organisation tridimensionnelle (ou repliement) qui lui est propre. De la séquence au repliement, il existe 4 niveaux de structuration de la protéine.

    Structure primaire
    [​IMG]
    Schéma général d'un acide aminé impliqué dans la structure primaire d'une protéine. R représente la chaîne latérale du résidu.

    La structure primaire, ou séquence, d'une protéine correspond à la succession linéaire des acides aminés (ou résidus) la constituant sans référence à une configuration spatiale. Les protéines sont donc des polymères d'acides aminés, reliés entre eux par des liaisons peptidiques.La structure primaire d'une protéine est le fruit de la traduction de l'ARNm en séquence protéique par le ribosome. C'est grâce au code génétique que l'information génétique (sous forme d'ARN) est traduite en acides aminés. Concrètement, la structure primaire est représentée par une succession de lettres (20 différentes) correspondant aux 20 acides aminés existants.


    [​IMG]
    Polarité, extrémités N- et C-terminales
    La séquence primaire d'une protéine a un sens bien défini ou polarité. Le premier acide aminé de la séquence de la protéine est par convention celui qui possède une extrémité amine libre, on parle d'extrémité N-terminale ou de N-terminal. De manière symétrique le dernier acide aminé est celui qui possède une extrémité carboxylate libre, on parle de C-terminal.

    Exemple d'une séquence d'acide aminé, l'α-lactalbumine humaine :

    MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAI
    VENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGI
    DYWLAHKALCTEKLEQWLCEKL

    Il existe des méthodes expérimentales de détermination de la structure primaire.

    Structure secondaire


    La structure secondaire décrit le repliement local de la chaîne principale d'une protéine. L'existence de structures secondaires vient du fait que les repliements

    énergétiquement favorables de la chaîne peptidique sont limités et que seules certaines conformations sont possibles. Ainsi, une protéine peut être décrite par une séquence d'acides aminés mais aussi par un enchaînement d'éléments de structure secondaire. De plus certaines conformations se trouvent nettement favorisées car stabilisées par des liaisons hydrogènes entre les groupements amide (-NH) et carbonyle (-CO) du squelette peptidique. Il existe trois principales catégories de structures secondaires selon l'échafaudage de liaisons hydrogènes, et donc selon le repliement des liaisons peptidiques : les hélices, les feuillets et les coudes. Il existe des méthodes expérimentales pour déterminer la structure secondaire comme la résonance magnétique nucléaire, le dichroïsme circulaire ou certaines méthodes de spectroscopie infrarouge.

    Angles dièdres et structure secondaire

    La chaîne principale contient trois liaisons covalentes par acide aminé. La liaison peptidique étant une liaison plane, il reste deux liaisons simples autour desquelles la rotation est possible. On peut donc déterminer la conformation du squelette d'un acide aminé à partir de deux angles dièdres, φ et ψ.
    • L'angle dièdre φ est défini par les quatre atomes successifs du squelette : CO-NH-Cα-CO, le premier carbonyle étant celui du résidu précédent.
    • L'angle dièdre ψ est défini par les quatre atomes successifs du squelette : NH-Cα-CO-NH, le second amide étant celui du résidu suivant.
    Toutes les valeurs des angles φ et ψ ne sont pas possibles car certaines conduisent à des contacts trop proches entre atomes qui sont énergétiquement très défavorables. Une étude systématique des combinaisons admissibles d'angles φ et ψ a été réalisé par le biologiste et physicien indien Gopalasamudram Narayana Ramachandran en 1963.

    Il a imaginé une représentation sous forme graphique de l'espace (φ ,ψ) qui porte aujourd'hui le nom de diagramme de Ramachandran. Ce diagramme montre trois principales zones énergétiquement favorables. Lorsqu'on analyse une structure de protéine, on observe que la majeure partie des acides aminés ont des combinaisons d'angles (φ ,ψ) qui s'inscrivent à l'intérieur de ces zones. Les deux principales régions correspondent aux structures secondaires régulières qui sont principalement observées dans les protéines : la région des hélices α et celle des feuillets β. La troisième région, plus petite, correspond à une conformation en hélice gauche (φ>0). · Il y a deux acides aminés particuliers qui font exception à cette règle du diagramme de Ramachandran : la Glycine et la Proline. La glycine ne possède pas de chaîne latérale (R=H) et, de ce fait, est beaucoup moins contrainte sur le plan de l'encombrement stérique. Elle peut donc adopter des valeurs (φ, ψ) beaucoup plus diversifiées, en dehors des régions normalement privilégiées. À l'inverse, la proline est plus contrainte: elle contient un cycle pyrrole qui empêche la rotation correspondant à l'angle φ.

    Hélice

    Il y a conformation en hélice lorsque le squelette principal de la protéine adopte un repliement hélicoïdal périodique. Dans l'immense majorité des cas, cette hélice tourne dans le sens horaire. Elle est alors dite «droite». Inversement, lorsqu'une hélice tourne dans le sens anti-horaire, elle est dite «gauche». Il existe aussi des enroulements superhélicoïdaux où 2 hélices, voire plus, s'enroulant l'une autour de l'autre pour former une superhélice. Ce type de conformation, ou faisceau d'hélices (coiled-coil) n'est pas une structure secondaire mais bien un type particulier de structure tertiaire, présent en particulier dans les protéines formant des fibres (e.g. fibrine, kératine, myosine).

    - Hélice α

    L'hélice α est une structure périodique très fréquente dans le repliement des protéines et des peptides. Elle se caractérise par la formation de liaisons hydrogènes entre le groupement carbonyle -CO d'un résidu i et le groupement amide -NH d'un résidu i+4. Un tour d'hélice α moyen contient 3,6 résidus et mesure 0.54 nm, soit une translation de 0.15 nm par résidu. Les angles dièdres φ et ψ de la chaîne peptidique sont en moyenne de -57° et -47° dans une hélice α. Dans une hélice α, les chaînes latérales des acides aminés sont localisées en périphérie de l'hélice et pointent vers l'extérieur (voir figure). C'est une structure compacte, énergétiquement favorable. La structure de l'hélice α a été prédite par Linus Pauling et Robert Corey en 1951, à partir de considérations théoriques, avant d'être observée effectivement pour la première fois en 1958 dans la myoglobine, la première protéine dont la structure tridimensionnelle a été résolue par cristallographie.

    - Hélice 3[SUB]10[/SUB]

    L'hélice 3[SUB]10[/SUB] se caractérise par la formation d'une liaison hydrogène entre le groupement -CO d'un résidu i et le groupement -NH d'un résidu i+3. Un pas d'hélice 3[SUB]10[/SUB] moyen contient 3 résidus et mesure 0.60 nm, soit une translation de 0.2 nm par résidu. Les angles dièdres φ et ψ des liaisons peptidiques sont en moyenne de -49.0° et -26.0°. Le tour d'hélice 3[SUB]10[/SUB] est donc plus étroit et plus contraint que celui de l'hélice α. Ce type de conformation est peu fréquent et sa longueur dépasse rarement 1 à 2 tours.

    - Hélice π

    L'hélice π se caractérise par la formation d'une liaison hydrogène entre le groupement CO d'un résidu i et le groupement NH d'un résidu i+5. Un pas d'hélice π moyen contient 4 résidus et mesure 0.50 nm, soit une translation de 0.11 nm par résidu. Les angles dièdres φ et ψ des liaisons peptidiques sont en moyenne de -57.1° et -69.7°. Le tour d'hélice π est donc plus large que celui de l'hélice α. Ce type de conformation est très rare.

    - Hélice de type II

    Les hélices de type II sont des hélices gauches formées par des poly-glycines ou des poly-prolines. Un pas moyen d'hélice de type II contient 3 résidus et mesure 0.93 nm, soit une translation de 0.31 nm par résidu. Les angles dièdres φ et ψ des liaisons peptidiques sont en moyenne de -79.0° et +145.0°.

    Brin et feuillet β

    Le brin β est une structure périodique étendue. Les liaisons hydrogènes qui le stabilisent se font entre résidus distants plutôt qu'entre résidus consécutifs, comme dans le cas de l'hélice α. En fait, un brin β seul n'est pas stable. Il a besoin de former des liaisons hydrogènes avec d'autres brins β pour se stabiliser. On parle alors de feuillets β. Un brin β est une structure de période 2, dont les chaînes latérales sont situées alternativement au dessus et en dessous du plan du feuillet.

    Grossièrement, le brin β peut être vu comme une hélice avec un pas de 2 acides aminés. Les brins β composant un feuillet ont une polarité, celle de la chaîne peptidique qui va du N-terminal vers le C-terminal. Lors de l'agencement de deux brins adjacents dans un feuillet, deux topologies sont possibles : soit les deux brins ont la même orientation, soit ils ont des orientations opposées. Dans le premier cas, on parle de brins parallèles et dans le dernier de brins anti-parallèles. Les feuillets β ne sont pas plans, ils présentent un plissement sur leur surface, avec des plis alternativement orientés vers le haut et vers le bas.

    - Feuillet β anti-parallèle

    Lorsque les brins β s'organisent de manière tête-bêche, ils forment un feuillet β anti-parallèle. Les groupements -NH et -CO d'un résidu i d'un brin A forment des liaisons hydrogènes avec les groupements -CO et -NH d'un résidu j d'un brin B. Typiquement, 2 brins β consécutifs relié par un coude forment un feuillet β anti-parallèle. Un brin β moyen dans un feuillet anti-parallèle mesure 0.68 nm, soit une translation de 0.34 nm par résidu. Les angles dièdres φ et ψ des liaisons peptidiques sont en moyenne de -139.0° et +135.0°.

    [​IMG]
    Structures en feuillets β. En haut, feuillet anti-parallèle, en bas, feuillet parallèle

    - Feuillet β parallèle

    Lorsque les brins β sont tous orientés dans le même sens, ils se forment en un feuillet β parallèle. Ainsi, 2 brins β consécutifs ne peuvent former un feuillet β parallèle. Les groupements -NH et -CO d'un résidu i d'un brin A forment des liaisons hydrogènes avec les groupements -CO d'un résidu et -NH d'un résidu j+2 appartenant à un brin B. Un brin β moyen dans un feuillet parallèle mesure 0.64 nm, soit une translation de 0.32 nm par résidu, Les angles dièdres φ et ψ des liaisons peptidiques sont en moyenne de -119.0° et +113.0°. Un feuillet β est bien souvent composé de brins parallèles et anti-parallèles. Les feuillets β peuvent être plats mais ont plutôt tendance à former une structure légèrement gauche.

    Coudes

    Les coudes ne sont pas des structures périodiques. Il s'agit plutôt d'un repliement particulier du squelette carboné localisé à 3 ou 4 résidus consécutifs. Les coudes permettent bien souvent de relier 2 structures secondaires périodiques (hélices et/ou brins). Ils peuvent s'oxyder.

    - Coudes de type I, II et III

    Dans les coudes de type I, II et III, il y a formation d'une liaison hydrogène entre le groupe -CO d'un résidu i et les groupement -NH d'un résidu i+3. Ces coudes courent donc sur 4 résidus. Ils sont regroupés sous l'appellation de coude β car ils font souvent le lien entre 2 brins β. Le tableau 1 récapitules les angles φ et ψ privilégiés des résidus au centre du coude. Un coude de type III correspond à un tour d'hélice 3[SUB]10[/SUB]. Certains acides aminés ont tendance à être favorisés à certaines positions des coudes selon leur encombrement stérique et/ou les angles dièdres qu'ils peuvent former (voir Tableau 2). Il existe également des coudes de type I', II' et III' qui sont les images miroir des coudes décrit ci-dessus. Leurs angles dièdres sont les opposés de ceux décrits dans le Tableau 1.

    - Coude γ

    Dans les coudes γ, il y a formation d'une liaison hydrogène entre le groupe -CO d'un résidu i et les groupements -NH d'un résidu i+2. Ces coudes courent donc sur 3 résidus. Les angles φ et ψ du résidu i+1 sont de +80.0° et -65.0°, respectivement. Il existe des coudes γ' avec des angles dièdres de -80.0° et +65.0°

    Autres structures secondaires

    Lorsque la conformation locale d'un segment protéique ne correspond à aucune de ces structures secondaires, on dit qu'il adopte une conformation en pelote statistique non périodique (random coil), par opposition aux hélices et aux feuillets qui sont des structures périodiques. Ce type de structure est le plus souvent associé aux boucles présentes entre 2 hélices ou feuillets. Pelote statistique ne signifie pas pour autant absence de structuration. Ainsi, certaines protéines ne possèdent aucun élément de structure secondaire régulière (hélice ou feuillet) mais ont une structure parfaitement stable. C'est souvent le cas des hormones et toxines polypeptidiques.

    Structure tertiaire


    La structure tertiaire d'une protéine correspond au repliement de la chaîne polypeptidique dans l'espace. On parle plus couramment de structure tridimensionnelle. La structure tridimensionnelle d'une protéine est intimement liée à sa fonction: lorsque cette structure est cassée par l'emploi d'agent dénaturant, la protéine perd sa fonction: elle est dénaturée.

    Dépendance de sa séquence

    La structure tertiaire d'une protéine dépend de sa structure primaire. Ainsi, deux protéines homologues ayant une forte similarité de séquence (> 80 % des acides aminés identiques) auront également des structures très proches. La prédiction de la structure tertiaire à partir de la structure primaire est à l'heure actuelle un champ très actif de la recherche en bio-informatique. Et de nombreuses méthodes utilisent justement l'homologie entre protéines pour réaliser leurs prédictions. Il est également connu de longue date que certains acides aminés favorisent la formation d'une structure secondaire plutôt qu'une autre. Par exemple, la proline et la glycine ont une très faible propension a former des hélices α. En fait, de nombreuses méthodes bioinformatiques de prédiction de la structure tertiaire utilisent uniquement la séquence des protéines pour réaliser leurs prédictions.

    Dépendance de son environnement
    La structure tertiaire d'une protéine dépend aussi de son environnement. Les conditions locales qui existent à l'intérieur de chaque compartiment cellulaire, le solvant, la force ionique, la viscosité, la concentration, contribuent à moduler la conformation. Ainsi une protéine soluble dans l'eau aura besoin d'un environnement aqueux pour adopter sa structure tridimensionnelle. De même, une protéine membranaire aura besoin de l'environnement hydrophobe de la membrane pour adopter une conformation.

    - Effet hydrophobe

    La séquence d'une protéine comporte une certaine proportion d'acides aminés polaires (hydrophiles) et non polaires (hydrophobes). Leurs interactions avec les molécules d'eau conditionnent la manière dont la chaîne polypeptidique se replie. Les acides aminés non polaires auront tendance à éviter l'eau. Inversement les résidus polaires vont chercher à rester à proximité du solvant aqueux. Ainsi, dans le cas des protéines solubles, il se forme un cœur hydrophobe au centre de la structure tertiaire, tandis que les groupes polaires restent plutôt en surface. Dans le cas des protéines transmembranaires le problème est inverse. L'environnement membranaire est globalement hydrophobe. Ainsi, les acides aminés hydrophiles vont se retrouver au cœur de la protéine tandis que les acides aminés hydrophobes vont se retrouver en surface. Des résidus hydrophiles peuvent se retrouver à la surface des protéines membranaires, en contact avec le milieu hydrophobe. Dans ce cas, il y a de forte chance que ces résidus soient impliqués dans des interactions avec d'autres résidus hydrophiles de la même ou d'une autre protéine.

    - Protéines intrinsèquement non-structurées

    À l'heure actuelle, de plus en plus de chercheurs s'intéressent au cas des protéines intrinsèquement non structurées. Il s'agit de protéines généralement solubles n'ayant pas de structure tridimensionnelle particulière sauf lorsqu’elles entrent en interaction avec d'autres facteurs : une autre protéine par exemple. En fait, ce type de protéines est souvent associé à plusieurs fonctions biologiques, leur «souplesse» leur permettant de s'adapter à différentes interactions. Les protéines intrinsèquement non structurées représenteraient environ 10 % des génomes. Plus généralement, environ 40 % des protéines eucaryotes possèderaient une région intrinsèquement non structurée. Une base de données appelée Disprot fournit des informations supplémentaires sur ces protéines qui manquent de structure tridimensionnelle fixe. Celle-ci répertorie toutes les structures intrinsèquement désordonnées connues jusqu'à présent et est régulièrement mise à jour.

    Organisation

    Les protéines s'organisent souvent en domaines structuraux distincts. Cela correspond aux parties de la protéine acquérant une conformation indépendamment du reste de la structure. Parfois ces domaines structuraux sont associés à une fonction individuelle donnée de la protéine : fixation d'un ligand, reconnaissance d'un autre partenaire, ancrage membranaire... Ainsi, une protéine constituée de plusieurs domaines structuraux peut associer plusieurs fonctions distinctes. Il existe également dans les protéines des motifs structuraux. Ces motifs comptent quelques acides aminés et sont en général associés à des interactions bien précises. Par exemple, le motif « doigt de zinc » fixe l'ion Zn[SUP]2+[/SUP], qui est impliqué dans des interactions spécifiques avec l'ADN. Il existe aussi le motif «hélice-boucle-hélice» ("helix-loop-helix" motif) qui fixe l'ion calcium Ca[SUP]2+[/SUP]. Un motif peut être impliqué dans un domaine structural. La représentation de la structure tertiaire se fait à l'aide d'un logiciel de visualisation comme Rasmol. Lors de cette représentation, il est courant de faire apparaître certaines caractéristiques particulières des structures, comme les structures secondaires. Par exemple une hélice α sera représentée par un cylindre et les brins β qui composent les feuillets β par des rubans en forme de flèches, etc. La structure tertiaire est maintenue par différentes interactions:
    • interactions covalentes (ponts disulfures entre cystéines)
    • interactions électrostatiques (liaisons ioniques, liaisons hydrogènes)
    • interactions de van der Waals
    • interactions avec le solvant et l'environnement (ions, lipides...)

    Détermination de la structure tertiaire

    Différentes méthodes expérimentales permettent de découvrir la structure tertiaire des protéines. En général, il convient d'ailleurs de combiner l'ensemble de ces techniques pour parvenir à la structure tertiaire :
    Ces méthodes sont coûteuses et la détermination de la structure d'une protéine reste un processus lent. Afin de pallier ce défaut, des méthodes automatiques de prédiction de la structure tertiaire des protéines ont été développées. Il se dégage deux types de méthodes :
    • Les méthodes basées sur les structures des protéines connues :
      • Les méthodes par homologie
      • Les méthodes par reconnaissance des repliements (ProteinThreading)

    • Les méthodes basées sur d'autres données (les propriétés physico-chimiques des atomes par exemple) :
      • Les méthodes ab initio
      • Les méthodes de novo


    Structure quaternaire

    La structure quaternaire des protéines regroupe l'association d'au moins deux chaînes polypeptidiques - identiques ou différentes - par des liaisons non-covalentes, liaisons dîtes faibles (liaison H, liaison ionique, interactions hydrophobes et force de Van der Waals), mais rarement par des ponts disulfures, qui ont pour rôle de créer les liaisons inter chaîne. L'effet hydrophobe est un facteur prépondérant dans l'assemblage des éléments structuraux, y compris dans l'association des sous-unités. Chacune de ces chaînes est appelée monomère (ou sous-unité) et l'ensemble oligomère ou protéine multimérique. L'hémoglobine est un exemple de structure quaternaire ; elle est constituée de 4 sous-unités : 2 sous-unités α (de 141 acides aminés) et 2 sous-unités β (de 146 acides aminés).


    Interactions responsables de la stabilité conformationnelle des protéines

    Il est généralement admis que la structure d'une protéine «native» est thermodynamiquement la structure la plus stable. À l'exception des ponts disulfures qui n'existent que dans certaines protéines, principalement les protéines exocellulaires, les interactions qui stabilisent la conformation de ces molécules sont des interactions non covalentes. Toutes les interactions de ce type qui interviennent dans les petites molécules existent également dans les protéines. D'autre part, les interactions non covalentes ont lieu entre les divers groupes d'une protéine, mais aussi entre ces groupes et les molécules de solvant. Ainsi l'énergie conformationnelle d'une molécule protéique est la somme de plusieurs contributions. Certaines de ces contributions résultent de facteurs intrinsèques à la protéine : ce sont les interactions de Van der Waals (non-bonded interactions) qui comportent un terme d'attraction et un terme de répulsion, les potentiels de torsions, les énergies de contraintes dans les angles ou les longueurs de liaison. D'autres proviennent d'interactions intramoléculaires influencées par le solvant, comme les liaisons hydrogène et les interactions électrostatiques. D'autres enfin sont principalement déterminées par le solvant, ce sont les interactions hydrophobes. Les liaisons hydrogène et les interactions hydrophobes présentent une dépendance de signe opposé par rapport à la température. Les liaisons hydrogène sont plus stables à basse température, à l'inverse des interactions hydrophobes; par suite la température correspondant au maximum de stabilité dépend de la proportion de ces interactions et par conséquent varie d'une protéine à l'autre. La structure native d'une protéine résulte d'un équilibre subtil entre différentes interactions stabilisantes et l'entropie conformationnelle qui tend à déstabiliser l'ensemble.

    Recherche

    Les projets suivants cherchent à mieux comprendre la structure des protéines :
    • Docking@home (Université du Texas - El Paso)
    • Folding@home (Université Stanford)
    • Proteins@home (École Polytechnique)
    • Rosetta@home (Université de Washington)
    • SPRINGS (Structural PRotein INformation Glossary Services) Université Pierre et Marie Curie (Institut de minéralogie et de Physique des Milieux Condensés), Université d'Arizona (Scientific Data Management Lab.) et Translational Genomics Research Institute (Pharmaceutical Genomics Division)
    • RPBS (Ressource Parisienne en Bioinformatique Structurale)
    • Foldit (Université de Washington)


     
  15. Sweetime

    Sweetime Quiet..

    J'aime reçus:
    79
    Points:
    28
    Lalla Gazelle merci .
     
  16. titegazelle

    titegazelle سُبحَانَ اللّهِ وَ بِحَمْدِهِ Membre du personnel

    J'aime reçus:
    4181
    Points:
    113
    Mais de rien !
    Tout le plaisir est pour moi, Lalla Sweetime.
    Merci à toi aussi :)
     

Partager cette page